Skip to product information
1 of 1

Research Scientific

VIP (Vasoactive Intestinal Peptide) - Research Grade Peptide

VIP (Vasoactive Intestinal Peptide) - Research Grade Peptide

Regular price £91.80 GBP
Regular price Sale price £91.80 GBP
Sale Sold out
Taxes included. Shipping calculated at checkout.
Weight

VIP (Vasoactive Intestinal Peptide) – Research-Grade 28-Residue Peptide

For research purposes only. This product is supplied exclusively for scientific laboratory research and analytical purposes. It is not intended for human or animal use, consumption, clinical use or therapeutic application. It must not be used in any way that contravenes applicable laws or the requirements of the Medicines and Healthcare products Regulatory Agency.

  • Research-grade, sequence-defined Vasoactive Intestinal Peptide with batch documentation available where supplied
  • Defined linear peptide sequence comprising 28 amino-acid residues
  • C-terminally amidated structure corresponding to mature human VIP and aviptadil
  • Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials
  • Batch identity, chromatographic purity, molecular mass, peptide content and analytical specifications stated in the applicable Certificate of Analysis
  • Handled and supplied exclusively as a research-use laboratory material

VIP, also known as Vasoactive Intestinal Peptide, Vasoactive Intestinal Polypeptide or aviptadil, is a sequence-defined linear peptide comprising 28 amino-acid residues and a C-terminal asparaginamide. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage, analytical method development and peptide characterisation.

The stated nominal amount refers to the declared VIP or aviptadil peptide content of a single vial, subject to the applicable batch documentation and stated assay basis. Total vial mass may additionally include residual water, counter-ions or declared formulation components, which should be identified separately in the applicable Certificate of Analysis.

Where laboratory dissolution or reconstitution is required, the solvent, buffer, concentration, mixing procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal bacteriostatic-water instruction should not be applied to every VIP chemical form or laboratory preparation. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.

Important Molecular Identity Information

This PEP061 listing describes the mature, C-terminally amidated VIP structure: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2 .

The C-terminal asparaginamide is an integral part of the molecular identity. A related structure ending in a free asparagine carboxylic acid, Asn-OH, has a different elemental formula and molecular weight and should not be represented using the amidated VIP specification.

The applicable Certificate of Analysis should confirm the complete 28-residue sequence, C-terminal amidation, molecular formula, measured molecular mass, chromatographic purity, net peptide content and any acetate, trifluoroacetate or other counter-ion present in the supplied batch.

Premium ULTIMATE Laboratory Specification

ULTIMATE VIP

Additional Preparative HPLC Purification and More Stringent LPS Testing

A premium laboratory specification incorporating an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for demanding analytical research workflows.

The ULTIMATE VIP range is our premium research specification for laboratories requiring an enhanced level of peptide purification and batch quality control. Following the standard synthesis, C-terminal amidation and purification process, the finished VIP research material undergoes an additional preparative high-performance liquid chromatography purification stage intended to reduce further the level of chromatographically separable peptide-related, synthesis-related and process-related impurities.

ULTIMATE batches are also assessed under a more stringent bacterial endotoxin or lipopolysaccharide testing specification. The applicable analytical method, reporting units, method-suitability controls, acceptance criterion and batch result should be stated in the corresponding Certificate of Analysis where supplied.

Additional HPLC Purification
A further preparative high-performance liquid chromatography purification stage is completed after the standard VIP synthesis and purification workflow.
More Stringent LPS Testing
Assessed under the enhanced ULTIMATE bacterial endotoxin or lipopolysaccharide testing specification using the applicable batch-specific analytical method.
Premium Batch Specification
Intended for analytical projects requiring additional purification and batch-specific documentation covering sequence identity, terminal amidation, molecular mass and impurity control.
Regular or ULTIMATE?
For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, reference-material evaluation, peptide characterisation and general laboratory work, our Regular research-grade VIP product remains highly suitable and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin or lipopolysaccharide testing specification are specifically required.

ULTIMATE VIP remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Molecular identity, complete sequence, terminal amidation, chromatographic purity, net peptide content, molecular form, counter-ion content, residual solvents, water content, methionine oxidation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.

Chemical and Structural Information:

  • Catalogue Product Name: VIP (Vasoactive Intestinal Peptide)
  • Preferred Substance Name: Aviptadil
  • Alternative Names: VIP; Vasoactive Intestinal Peptide; Vasoactive Intestinal Polypeptide; human VIP; Vasoactive Intestinal Octacosapeptide
  • Material Classification: Synthetic sequence-defined linear peptide
  • Sequence Length: 28 amino-acid residues
  • Complete Modified Peptide Sequence: H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
  • One-Letter Sequence: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
  • Sequence-Based Description: L-histidyl-L-seryl-L-aspartyl-L-alanyl-L-valyl-L-phenylalanyl-L-threonyl-L-aspartyl-L-asparaginyl-L-tyrosyl-L-threonyl-L-arginyl-L-leucyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-asparaginyl-L-seryl-L-isoleucyl-L-leucyl-L-asparaginamide
  • N-Terminal Structure: Free L-histidine amino terminus
  • C-Terminal Structure: C-terminal L-asparaginamide
  • Cyclic or Linear Peptide: Linear peptide
  • Cysteine Content: None
  • Disulphide-Bond Content: None; the VIP sequence contains no cysteine residues
  • Methionine Content: One methionine residue
  • Sulphur Content: The single sulphur atom in the molecular formula is contributed by the methionine residue
  • CAS Number: 40077-57-4
  • Unique Ingredient Identifier: A67JUW790C
  • Human Precursor Reference: UniProt accession P01282
  • Molecular Formula: C147H238N44O42S
  • Average Molecular Weight: Approximately 3325.80 g/mol
  • Approximate Molecular Size: 3.33 kDa
  • Formula Basis: The molecular formula and molecular weight describe the mature, uncountered, C-terminally amidated VIP or aviptadil peptide without additional acetate, trifluoroacetate, residual water, solvents or formulation excipients
  • Free-Acid Variant Distinction: A related structure ending in Asn-OH rather than Asn-NH2 has a different elemental formula and molecular weight and should not be represented using the amidated VIP specification
  • Aviptadil Acetate Distinction: Aviptadil acetate is recorded as a separate supplied chemical form and its acetate content should be identified independently in the applicable batch documentation
  • Physical Form: Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis
  • Appearance: White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis
  • Purity Specification: The applicable chromatographic purity result, analytical method and acceptance criterion should be stated in the batch Certificate of Analysis
  • Purity Interpretation: Chromatographic purity represents the relative chromatographic composition measured under the stated analytical conditions and should not automatically be interpreted as equivalent to molecular identity or total net VIP peptide content
  • Peptide-Content Specification: Net VIP or aviptadil content should be distinguished from chromatographic purity and interpreted alongside counter-ion content, water content, residual solvents and formulation components
  • Nominal Amount Basis: The applicable product specification should state whether the declared vial quantity is expressed as anhydrous VIP peptide equivalent or as total supplied salt-form or formulated lyophilised material
  • Sequence Confirmation: The complete 28-residue amino-acid sequence should be confirmed using the applicable supplier, synthesis and batch records
  • C-Terminal Amidation Confirmation: Molecular-identity documentation should confirm the C-terminal asparaginamide and distinguish it from a free asparagine carboxylic acid terminal structure
  • Mass-Spectrometry Confirmation: Molecular identity should be supported by analytical mass data consistent with the specified C-terminally amidated VIP structure
  • Chemical-Form Confirmation: The applicable Certificate of Analysis should identify whether the supplied material is the uncountered parent peptide, an acetate-containing form, a trifluoroacetate-containing form or another counter-ion presentation
  • Counter-Ion Specification: Acetate, trifluoroacetate or another counter-ion may affect the total supplied material mass, formula-weight basis and calculated net peptide content
  • Water-Content Specification: Residual water and hydration state may contribute to the total material mass and should be stated or controlled through the applicable batch specification
  • Residual-Solvent Specification: Applicable residual solvents arising from peptide synthesis, cleavage, purification, concentration and lyophilisation should be stated or controlled through the batch specification
  • Methionine-Oxidation Control: Oxidation of the methionine residue is a distinct peptide-related quality attribute and should be assessed or controlled where required by the applicable batch specification
  • Related-Impurity Control: Deletion sequences, truncated peptides, incompletely amidated material, methionine oxidation products, incompletely deprotected sequences and other synthesis-related or process-related substances are separate quality attributes
  • Dissolution Method: The appropriate solvent, buffer, concentration and mixing procedure should be selected using the applicable batch documentation and validated laboratory method; a universal bacteriostatic-water instruction should not be applied to every VIP preparation
  • Endotoxin Specification: The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis
  • Sterility Distinction: A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process
  • Analytical Interpretation: Molecular identity, complete sequence, terminal amidation, chromatographic purity, net peptide content, methionine oxidation, water content, residual solvents, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together

Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.
Certificate of Analysis – Accessible through the product QR code where a completed batch-specific document has been published.
Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance where available.
Sequence documentation – The complete 28-residue amino-acid sequence should be confirmed using the applicable synthesis and batch records.
C-terminal modification documentation – C-terminal asparaginamide should be confirmed and distinguished from the corresponding free-acid structure.
Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified C-terminally amidated VIP structure.
Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.
Peptide-content documentation – Net VIP content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.
Chemical-form documentation – The parent peptide, acetate-containing, trifluoroacetate-containing or another counter-ion presentation should be identified clearly.
Oxidation-control documentation – Methionine oxidation should be assessed or controlled where required by the applicable research specification.
Bacterial endotoxin documentation – The applicable bacterial endotoxin or lipopolysaccharide result should identify the analytical method, reporting units, method-suitability controls and acceptance criterion.
Supplier documentation – Reviewed where supporting synthesis, terminal amidation, purification and analytical records are supplied.
Trackable laboratory delivery – Securely packaged and dispatched using transport controls appropriate to the applicable batch stability and storage specification.


For Research Use Only
This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.


VIP and Aviptadil Product Overview

Our research-grade VIP and aviptadil laboratory material is supplied for controlled analytical method development, peptide identity assessment, high-performance liquid chromatography evaluation, liquid chromatography–mass spectrometry workflows, impurity profiling, reference-material comparison and other scientific laboratory investigations.

The mature VIP molecule comprises a defined linear sequence of 28 amino-acid residues with a free N-terminal histidine and a C-terminal asparaginamide. The complete sequence is HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2. The molecule contains no cysteine residues and therefore has no intramolecular disulphide bonds.

The CAS number 40077-57-4, molecular formula C147H238N44O42S and average molecular weight of approximately 3325.80 g/mol describe the mature, uncountered and C-terminally amidated VIP molecule. Where the supplied laboratory material contains acetate, trifluoroacetate, residual water, solvents or formulation ingredients, the applicable batch documentation should identify their contribution to the total supplied material mass.

Product identity should not be assigned from the product name or CAS number alone. The complete sequence, C-terminal amidation and mass-spectrometry result should agree with the specified molecular structure. A related free-acid form ending Asn-OH would have a different molecular formula and mass.

The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, complete amino-acid sequence, terminal amidation, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, methionine oxidation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.

Chromatographic purity should not automatically be interpreted as equivalent to total net VIP content or proof of correct sequence and terminal amidation. Molecular identity should be assessed using the applicable combination of chromatographic, mass-spectrometry, peptide-content and batch-manufacturing documentation.

A bacterial endotoxin or lipopolysaccharide result does not establish sterility, complete molecular identity, correct terminal amidation, methionine oxidation status or the absence of every peptide-related and process-related impurity. Any sterility claim must be supported separately by an appropriate validated sterility test and controlled production documentation.

For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, impurity profiling, peptide characterisation and general laboratory work, the Regular VIP specification remains highly suitable. The premium black-and-gold ULTIMATE VIP option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for projects requiring enhanced quality-control parameters.

View Certificate of Analysis

View Safety Data Sheet

View full details