PNC-27 - Research Grade Peptide

PNC-27 – Research Grade Peptide

For research purposes only. This product is supplied exclusively for scientific laboratory research and analytical purposes. It is not intended for human or animal use and must not be used in any way that contravenes applicable laws or the requirements of the Medicines and Healthcare products Regulatory Agency.

• Research-grade PNC-27 peptide supplied exclusively for laboratory use.
• Supplied as lyophilised material in sealed, flip-top laboratory vials.
• Batch documentation available where supplied.

All of our peptides are supplied strictly for scientific research and laboratory use. The stated quantity applies to an individual vial unless the selected product option expressly identifies a multi-vial laboratory pack. Refer to the product label and applicable batch documentation for the declared peptide content, formulation and any additional components.

Chemical Information

• Product name: PNC-27
• Synonym: PNC-27.
• Chemical Abstracts Service registry number: Not specified in the supplied product information. Confirm the identifier applicable to the exact material and salt form supplied.
• Reference molecular formula: C₁₈₈H₂₉₃N₅₃O₄₄S.
• Reference average molar mass: Approximately 4,031.73 grams per mole.
• Calculated neutral monoisotopic mass: Approximately 4,029.204 daltons.
• Sequence length: 32 amino acid residues.
• Sequence as supplied: H-Pro-Pro-Leu-Ser-Gln-Glu-Thr-Phe-Ser-Asp-Leu-Trp-Lys-Leu-Leu-Lys-Lys-Trp-Lys-Met-Arg-Arg-Asn-Gln-Phe-Trp-Val-Lys-Val-Gln-Arg-Gly-OH.
• Single-letter sequence: PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRG.
• Terminal groups in the supplied sequence: Free amino terminus and free C-terminal carboxyl group.
• Physical presentation: Lyophilised laboratory material.
• Purity specification: Not specified in the supplied product information. Refer to the completed batch Certificate of Analysis for the analytical method, acceptance criterion and reported result.

The reference formula and mass values describe the peptide represented by the supplied sequence, excluding counterions, associated water and formulation ingredients. Average molar mass and monoisotopic mass are different quantities and should not be used interchangeably. These are reference and calculated values, not verified batch results. Confirm the identity, terminal structure, salt form and formulation against the manufacturer's specification.

Premium ULTIMATE Laboratory Specification

ULTIMATE PNC-27

Additional chromatographic purification and more stringent endotoxin testing

The ULTIMATE PNC-27 specification includes an additional preparative high-performance liquid chromatography purification stage after the standard purification process, together with a more stringent bacterial endotoxin testing specification for lipopolysaccharides. It provides an optional specification upgrade for laboratories with additional purification and quality-control requirements.

Additional Purification

A further preparative high-performance liquid chromatography stage beyond the Regular purification process.

More Stringent Endotoxin Testing

Assessed against the ULTIMATE bacterial endotoxin specification using the analytical method and acceptance criteria recorded for the batch.

Batch-Specific Assessment

Refer to the completed Certificate of Analysis for the identity, reported purity, endotoxin result and specification of the selected batch.

Regular or ULTIMATE?

Our Regular PNC-27 remains a suitable choice for routine laboratory work where its documented specification meets the requirements of the intended method. Select ULTIMATE where the additional purification stage and more stringent endotoxin specification are required by your laboratory procedure.

For research use only. The ULTIMATE designation does not, by itself, establish a numerical purity, an endotoxin limit or sterility. Confirm the relevant specification and results in the batch documentation. Neither grade is intended for human or animal use.

Laboratory Handling and Reconstitution

The supplied product description states that the lyophilised powder is sterile, finely milled and sieved. Confirm these processing and sterility claims against the relevant manufacturing and batch records before relying on them for a laboratory procedure.

The supplied product information identifies bacteriostatic water containing 0.9% benzyl alcohol, or a suitable equivalent, as the reconstitution medium. Confirm that the selected medium, concentration and handling conditions are compatible with the exact supplied formulation and your laboratory's validated analytical procedure.

Follow the product-specific handling, storage and disposal instructions. Research Scientific does not provide advice or recommendations regarding dosage, administration or use in humans or animals.

Batch Documentation and Delivery

Batch documentation: Available manufacturer and analytical records are provided where supplied. Match the documentation to the product name, selected grade and batch number before using it for laboratory quality assessment.

Certificate of Analysis: Review the completed batch certificate for the tests performed, analytical methods, reported results and applicable specifications. Use the code provided on the packaging, where available, or contact Research Scientific to confirm which documentation is available for the selected batch.

Safety Data Sheet: Consult the current, product-specific Safety Data Sheet for information supporting laboratory risk assessment, safe handling, storage and disposal.

Supplier documentation: Supplier records are reviewed where supplied. Confirm that the records relate to the actual peptide form, formulation and batch being supplied.

Tracked delivery: Securely packaged and dispatched frozen in insulated packaging using a tracked delivery service. Follow the product's storage instructions upon receipt.

---

For Research Use Only
This product is supplied strictly for scientific laboratory research and analytical purposes. Neither the Regular nor the ULTIMATE option is intended for human consumption, human or animal use, clinical use or therapeutic application.

---

PNC-27 Product Overview

Research Scientific supplies PNC-27 as a research-grade peptide for controlled laboratory handling and analytical work. Regular and ULTIMATE options allow laboratories to select the documented specification appropriate to their procedures. Confirm product identity, composition, peptide content and analytical results using the applicable batch documentation.

Product Documentation

Refer to the documentation supplied with the product or contact Research Scientific for the available PNC-27 Certificate of Analysis and Safety Data Sheet. Check that each document relates to the exact material and batch being supplied.