Research Scientific
LL-37 - Research Grade Peptide
LL-37 - Research Grade Peptide
Couldn't load pickup availability
LL-37 – Research-Grade 37-Residue Peptide
For research purposes only. This product is supplied exclusively for scientific laboratory research and analytical purposes. It is not intended for human or animal use, consumption, clinical use or therapeutic application. It must not be used in any way that contravenes applicable laws or the requirements of the Medicines and Healthcare products Regulatory Agency.
- Research-grade synthetic LL-37 peptide with batch documentation available where supplied
- Defined linear sequence comprising 37 amino-acid residues
- Human cathelicidin-derived peptide corresponding to residues 134–170 of the CAMP precursor
- Supplied as lyophilised laboratory material in sealed flip-top headspace vials
- Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis
- Handled and supplied exclusively as a research-use laboratory material
All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated nominal amount refers to the declared LL-37 peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.
ULTIMATE LL-37
Enhanced HPLC Purification and More Stringent LPS Testing
Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.
The ULTIMATE LL-37 range is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished LL-37 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.
ULTIMATE LL-37 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, amino-acid sequence, terminal structure, chromatographic purity, peptide content, molecular form, counter-ion content, aggregation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.
Chemical and Structural Information:
- Product Name: LL-37
- Preferred Substance Name: Ropocamptide
- Alternative Names: Cathelicidin LL-37; human LL-37; human cathelicidin-derived LL-37; antimicrobial peptide LL-37; hCAP18-derived LL-37
- Material Classification: Synthetic linear 37-residue peptide
- Sequence Length: 37 amino-acid residues
- Full Amino-Acid Sequence: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser
- One-Letter Sequence: [LL-37, 37 aa]
- Human Precursor Reference: Corresponds to residues 134–170 of the human cathelicidin antimicrobial peptide precursor, CAMP or hCAP18
- N-Terminal Structure: Free leucine amino terminus
- C-Terminal Structure: Free serine carboxylic acid terminus
- Disulphide-Bond Content: None; the LL-37 sequence contains no cysteine residues
- CAS Number: 154947-66-7
- PubChem Compound Identifier: CID 16198951
- Unique Ingredient Identifier: 3DD771JO2H
- Molecular Formula: C205H340N60O53
- Average Molecular Weight: Approximately 4493.3 g/mol
- Approximate Molecular Size: 4.49 kDa
- Formula Basis: The molecular formula and molecular weight describe the uncountered LL-37 peptide with free amino and carboxylic acid termini, without formulation excipients, residual water or additional counter-ions
- Physical Form: Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis
- Appearance: White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis
- Purity Specification: The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis
- Peptide-Content Specification: Net LL-37 peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results
- Chemical-Form Confirmation: The applicable Certificate of Analysis should identify whether the supplied material is uncountered LL-37, LL-37 acetate, LL-37 trifluoroacetate or another counter-ion form
- Counter-Ion Confirmation: Acetate, trifluoroacetate or another counter-ion may affect the recorded material mass, water content and net peptide content of the supplied laboratory material
- Identity Confirmation: Product identity should be supported by sequence documentation and mass-spectrometry results consistent with the specified 37-residue LL-37 structure
- Aggregation and Structural State: Aggregation, oligomerisation and secondary structure are separate quality attributes and are not established by a chromatographic purity percentage alone
- Endotoxin Specification: The applicable bacterial endotoxin or LPS result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis
- Analytical Interpretation: Molecular identity, amino-acid sequence, terminal structure, chromatographic purity, net peptide content, aggregation, water content, residual solvent content, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together
✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.
✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.
✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.
✓ Sequence documentation – The complete 37-residue amino-acid sequence and terminal structures should be confirmed using the applicable batch records.
✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified LL-37 structure.
✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.
✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.
✓ Chemical-form documentation – The free peptide, acetate form, trifluoroacetate form or other counter-ion form should be identified clearly in the applicable product and batch records.
✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, reporting units, method-suitability controls and acceptance criterion.
✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.
✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.
For Research Use Only
This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.
LL-37 Product Overview
Our LL-37 research-grade synthetic peptide, also known as ropocamptide or cathelicidin LL-37, is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and biochemical research. The material comprises a defined linear sequence of 37 amino-acid residues with a free N-terminal leucine and a free C-terminal serine carboxylic acid.
LL-37 corresponds to the C-terminal 37-residue peptide derived from the human cathelicidin antimicrobial peptide precursor, commonly identified as CAMP or hCAP18. The LL-37 research material should not be confused with the complete human cathelicidin precursor protein, which is a larger biological molecule with a different sequence, molecular formula and molecular weight.
The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, amino-acid sequence, terminal structure, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, aggregation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.
The CAS number 154947-66-7, molecular formula C205H340N60O53 and average molecular weight of approximately 4493.3 g/mol describe the uncountered LL-37 peptide. Where the supplied laboratory material contains acetate, trifluoroacetate or another counter-ion, the applicable batch documentation should identify the counter-ion and its contribution to the total material mass.
For the majority of routine analytical, biochemical, peptide-characterisation and general laboratory work, the Regular LL-37 specification remains highly suitable. The premium black-and-gold ULTIMATE LL-37 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.
Share
