Nupex
IGF-1 LR3 - Research Grade Peptide
IGF-1 LR3 - Research Grade Peptide
Couldn't load pickup availability
IGF-1 LR3 – Research-Grade Polypeptide
For research purposes only. This product is supplied exclusively for scientific laboratory research and analytical purposes. It is not intended for human or animal use, consumption, clinical use or therapeutic application. It must not be used in any way that contravenes applicable laws or the requirements of the Medicines and Healthcare products Regulatory Agency.
- Research-grade, sequence-defined 83-residue polypeptide with batch documentation available where supplied
- Long R3 IGF-I structure containing a 13-residue N-terminal extension and an arginine substitution within the IGF-I domain
- Supplied as lyophilised laboratory material in sealed flip-top headspace vials
- Batch identity, chromatographic purity, polypeptide content and analytical specifications stated in the applicable Certificate of Analysis
- Handled and supplied exclusively as a research-use laboratory material
All of our research polypeptides, proteins and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared IGF-1 LR3 content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.
ULTIMATE IGF-1 LR3
Enhanced HPLC Purification and More Stringent LPS Testing
Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.
The ULTIMATE IGF-1 LR3 range is our premium research specification for laboratories requiring an enhanced level of polypeptide purification and quality control. Following the standard production, folding and purification workflow, the finished IGF-1 LR3 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual process-related and product-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.
ULTIMATE IGF-1 LR3 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, sequence, chromatographic purity, polypeptide content, molecular form, disulphide-bond integrity, aggregation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.
Chemical and Structural Information:
- Product Name: IGF-1 LR3
- Preferred Scientific Description: Long R3 insulin-like growth factor I
- Alternative Names: Long R3 IGF-I; Long-R3-IGF-I; Long [Arg3] IGF-I; LR3 IGF-I; IGF-I LR3
- Material Classification: Sequence-defined, modified 83-residue polypeptide
- Reference Structural Form: Single, non-glycosylated polypeptide chain containing three intramolecular disulphide bonds
- Sequence Length: 83 amino-acid residues
- Full Amino-Acid Sequence: MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
- N-Terminal Extension: MFPAMPLSSLFVN
- N-Terminal Extension Length: 13 amino-acid residues
- IGF-I Domain Modification: Arginine replaces glutamic acid at position 3 of the mature IGF-I domain
- N-Terminal Structure: Free methionine amino terminus
- C-Terminal Structure: Free alanine carboxylic acid terminus
- Disulphide-Bond Content: Three intramolecular disulphide bonds in the correctly folded reference structure
- CAS Number: 143045-27-6
- Folded Polypeptide Molecular Formula: C400H619N111O115S9
- Average Molecular Weight: Approximately 9111.45 g/mol
- Approximate Molecular Size: 9.1 kDa
- Formula Basis: The molecular formula and molecular weight describe the folded, disulphide-bonded, untagged polypeptide without formulation excipients, counter-ions, water or other batch-dependent components
- Physical Form: Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis
- Appearance: White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis
- Production Method: The expression system, synthesis route, purification procedure and folding process should be confirmed using the applicable supplier and batch documentation
- Tag Status: The presence or absence of an affinity tag, linker sequence or additional terminal residues should be confirmed using sequence and mass-spectrometry documentation for the applicable batch
- Purity Specification: The applicable chromatographic purity result and analytical method are stated in the batch Certificate of Analysis
- Polypeptide Content: Net polypeptide content should be determined independently of chromatographic purity and interpreted alongside water, formulation and residual-solvent results
- Aggregation and Folding: Monomeric state, aggregation, folding and disulphide-bond integrity are separate quality attributes and are not established by a chromatographic purity percentage alone
- Endotoxin Specification: The applicable bacterial endotoxin or LPS result, test method, reporting units and acceptance limit should be stated in the batch Certificate of Analysis
- Analytical Interpretation: Molecular identity, chromatographic purity, net polypeptide content, structural integrity, aggregation, water content, residual solvent content, formulation components and bacterial endotoxin results are separate analytical measurements and should be interpreted together
✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.
✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.
✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.
✓ Sequence documentation – The 83-residue amino-acid sequence, N-terminal extension and arginine substitution should be confirmed using the applicable batch records.
✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified IGF-1 LR3 structure.
✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.
✓ Polypeptide-content documentation – Net polypeptide content should be distinguished from chromatographic purity and interpreted alongside water, formulation and residual-solvent results.
✓ Structural documentation – Folding, disulphide-bond integrity, monomeric state and aggregation should be assessed using appropriate product-specific analytical methods where required.
✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, acceptance criterion and reporting units.
✓ Supplier documentation – Reviewed where supporting production, folding, purification and analytical records are supplied.
✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.
For Research Use Only
This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.
IGF-1 LR3 Product Overview
Our IGF-1 LR3 research-grade polypeptide, also known as Long R3 IGF-I, is supplied for controlled scientific laboratory investigation, analytical method development, polypeptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and cell-culture reagent evaluation. The material comprises a defined sequence of 83 amino-acid residues containing a 13-residue N-terminal extension and an arginine substitution at position 3 of the mature IGF-I domain.
The reference IGF-1 LR3 structure is a single, non-glycosylated polypeptide chain containing three intramolecular disulphide bonds. Product identity, molecular mass, chromatographic purity, net polypeptide content, sequence integrity, terminal structure, folding, disulphide-bond integrity, aggregation, formulation composition, residual solvents, water content and bacterial endotoxin results should be confirmed using the applicable batch Certificate of Analysis and supporting analytical records.
Chromatographic purity should not automatically be interpreted as equivalent to the total net polypeptide content of the vial. Similarly, a bacterial endotoxin or LPS result does not establish sterility, structural integrity, biological activity or the absence of other process-related impurities.
For the majority of routine analytical, biochemical, cell-culture and general laboratory work, the Regular IGF-1 LR3 specification remains highly suitable. The premium black-and-gold ULTIMATE IGF-1 LR3 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.
Share
