IGF-1-DES - Research Grade Peptide

IGF1-DES – Research-Grade Polypeptide

For research purposes only. This product is supplied exclusively for scientific laboratory research and analytical purposes. It is not intended for human or animal use, consumption, clinical use or therapeutic application. It must not be used in any way that contravenes applicable laws or the requirements of the Medicines and Healthcare products Regulatory Agency.

• Research-grade, sequence-defined 67-residue polypeptide with batch documentation available where supplied
• DES(1–3) IGF-I structure lacking the N-terminal Gly-Pro-Glu tripeptide of full-length human IGF-I
• Supplied as lyophilised laboratory material in sealed flip-top headspace vials
• Batch identity, chromatographic purity, polypeptide content and analytical specifications stated in the applicable Certificate of Analysis
• Handled and supplied exclusively as a research-use laboratory material

All of our research polypeptides, proteins and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated nominal amount refers to the declared IGF1-DES content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.

Chemical and Structural Information:

• Product Name: IGF1-DES
• Preferred Scientific Description: DES(1–3) human insulin-like growth factor I
• Alternative Names: IGF-1 DES; DES IGF-I; DES(1–3) IGF-I; IGF-I (4–70); truncated human IGF-I
• Material Classification: Sequence-defined 67-residue polypeptide
• Reference Structural Form: Single-chain polypeptide containing three intramolecular disulphide bonds
• Sequence Length: 67 amino-acid residues
• Full Amino-Acid Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
• Sequence Origin: Residues 4–70 of mature human IGF-I
• Deleted N-Terminal Residues: Gly-Pro-Glu
• N-Terminal Structure: Free threonine amino terminus
• C-Terminal Structure: Free alanine carboxylic acid terminus
• Reference Disulphide Bonds Using IGF1-DES Numbering: Cys³–Cys⁴⁵, Cys¹⁵–Cys⁵⁸ and Cys⁴⁴–Cys⁴⁹
• Primary CAS Number: 112603-35-7
• Unique Ingredient Identifier: AG0WVP88OA
• Sequence-Derived Reduced-Chain Molecular Formula: C₃₁₉H₅₀₁N₉₁O₉₆S₇
• Reference Folded Molecular Formula: C₃₁₉H₄₉₅N₉₁O₉₆S₇
• Formula Explanation: Formation of the three reference intramolecular disulphide bonds removes six hydrogen atoms from the fully reduced polypeptide-chain formula
• Approximate Molecular Weight: Approximately 7.37 kDa, with the reported value dependent upon whether the reduced or disulphide-bonded molecular form and the average or monoisotopic mass convention are used
• Physical Form: Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis
• Appearance: Refer to the applicable batch Certificate of Analysis
• Production Method: The expression system, chemical synthesis route, purification procedure and folding process should be confirmed using the applicable supplier and batch documentation
• Tag Status: The presence or absence of any affinity tag, linker, terminal extension or additional residue should be confirmed using sequence and mass-spectrometry documentation for the applicable batch
• Purity Specification: The applicable chromatographic purity result and analytical method are stated in the batch Certificate of Analysis
• Polypeptide Content: Net polypeptide content should be determined independently of chromatographic purity and interpreted alongside water, formulation, counter-ion and residual-solvent results
• Aggregation and Folding: Monomeric state, aggregation, folding and disulphide-bond integrity are separate quality attributes and are not established by a chromatographic purity percentage alone
• Endotoxin Specification: The applicable bacterial endotoxin or LPS result, test method, reporting units and acceptance limit should be stated in the batch Certificate of Analysis
• Analytical Interpretation: Molecular identity, chromatographic purity, net polypeptide content, structural integrity, aggregation, water content, residual solvent content, formulation components and bacterial endotoxin results are separate analytical measurements and should be interpreted together

✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.
✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.
✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.
✓ Sequence documentation – The 67-residue amino-acid sequence and deletion of the N-terminal Gly-Pro-Glu tripeptide should be confirmed using the applicable batch records.
✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified IGF1-DES structure.
✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.
✓ Polypeptide-content documentation – Net polypeptide content should be distinguished from chromatographic purity and interpreted alongside water, formulation and residual-solvent results.
✓ Structural documentation – Folding, disulphide-bond integrity, monomeric state and aggregation should be assessed using appropriate product-specific analytical methods where required.
✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, acceptance criterion and reporting units.
✓ Supplier documentation – Reviewed where supporting production, folding, purification and analytical records are supplied.
✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.

For Research Use Only
This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.

IGF1-DES Product Overview

Our IGF1-DES research-grade polypeptide, also known as DES(1–3) IGF-I, is supplied for controlled scientific laboratory investigation, analytical method development, polypeptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and cell-culture reagent evaluation. The material comprises a defined sequence of 67 amino-acid residues corresponding to mature human IGF-I without its first three N-terminal residues, Gly-Pro-Glu.

The reference structure is a single polypeptide chain containing three intramolecular disulphide bonds. Product identity, molecular mass, chromatographic purity, net polypeptide content, sequence integrity, terminal structure, folding, disulphide-bond integrity, aggregation, formulation composition, residual solvents, water content and bacterial endotoxin results should be confirmed using the applicable batch Certificate of Analysis and supporting analytical records.

Chromatographic purity should not automatically be interpreted as equivalent to the total net polypeptide content of the vial. Similarly, a bacterial endotoxin or LPS result does not establish sterility, structural integrity, biological activity or the absence of other process-related impurities.

For the majority of routine analytical, biochemical, cell-culture and general laboratory work, the Regular IGF1-DES specification remains highly suitable. The premium black-and-gold ULTIMATE IGF1-DES option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.

View Certificate of Analysis

View Safety Data Sheet