{"title":"Buy Research Peptides UK: Pure, Lab-Tested \u0026 Trusted Source","description":"","products":[{"product_id":"5-amino-1mq-research-peptide","title":"5-AMINO-1MQ – Research Grade Peptide","description":"\u003cdiv class=\"research-scientific-product-description\" lang=\"en-GB\" style=\"box-sizing: border-box; width: 100%; max-width: 100%; min-width: 0; font-family: Arial, Helvetica, sans-serif; font-size: 15px; line-height: 1.7; color: #222222; text-align: left; overflow-wrap: anywhere;\"\u003e\n\n \u003ch3 id=\"5amino1mqresearchgradecompound\" style=\"margin: 0 0 18px; color: #00455f; font-size: 20px; line-height: 1.35;\"\u003e\n 5-AMINO-1MQ – Research Grade Compound\n \u003c\/h3\u003e\n\n \u003cdiv role=\"note\" aria-labelledby=\"research-only-5amino\" style=\"box-sizing: border-box; margin: 0 0 22px; padding: 18px 20px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; border-radius: 12px; font-size: 15px; line-height: 1.7;\"\u003e\n \u003ch4 id=\"research-only-5amino\" style=\"margin: 0 0 10px; color: #c00000; font-size: 16px; line-height: 1.45;\"\u003e\n For research purposes only\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n This product is supplied exclusively for scientific laboratory research and\n analytical purposes. It is not intended for human or animal use, including\n human consumption, or for clinical, diagnostic or therapeutic applications.\n \u003c\/p\u003e\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n It must not be misused in any way that contravenes the requirements of the\n Medicines and Healthcare products Regulatory Agency or applicable laws.\n Research Scientific does not provide advice or recommendations concerning\n dosage, administration or use in humans or animals.\n \u003c\/p\u003e\n \u003cp style=\"margin: 0;\"\u003e\n \u003cstrong\u003eThese restrictions apply to both Regular and ULTIMATE products.\u003c\/strong\u003e\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cul style=\"margin: 0 0 20px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eResearch-grade 5-AMINO-1MQ supplied exclusively for laboratory and analytical work.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eSupplied as lyophilised powder in flip-top headspace vials.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eBatch-specific documentation available where supplied.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp id=\"productoverview\" style=\"margin: 0 0 20px;\"\u003e\n Research Scientific supplies \u003cstrong\u003e5-Amino-1MQ research compound\u003c\/strong\u003e for\n analytical, investigative and exploratory scientific laboratory work. The product\n is intended for appropriately equipped academic, commercial and independent\n research laboratories, with an emphasis on consistent handling, traceability\n and documented quality control.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n \u003cstrong\u003eThe stated weight refers to the contents of a single vial.\u003c\/strong\u003e\n Refer to the product label and applicable batch documentation for the declared\n compound content, exact formulation and any additional ingredients.\n \u003c\/p\u003e\n\n \u003csection aria-labelledby=\"chemicalinformation\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"chemicalinformation\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Chemical Information\n \u003c\/h3\u003e\n\n \u003cul style=\"margin: 0 0 18px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eProduct name:\u003c\/strong\u003e 5-AMINO-1MQ.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eChemical name, as supplied:\u003c\/strong\u003e 5-Amino-1-methylquinolin-1-ium.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eChemical Abstracts Service registry number, as supplied:\u003c\/strong\u003e\n 1190315-88-7.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eMolecular formula, as supplied:\u003c\/strong\u003e\n C\u003csub\u003e10\u003c\/sub\u003eH\u003csub\u003e11\u003c\/sub\u003eN\u003csub\u003e2\u003c\/sub\u003e\u003csup\u003e+\u003c\/sup\u003e.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eMolar mass, as supplied:\u003c\/strong\u003e 159.21 grams per mole.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003ePhysical presentation:\u003c\/strong\u003e Lyophilised laboratory powder.\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eSpecification clarification:\u003c\/strong\u003e\n The chemical name, registry number, formula and molar mass above are retained\n from the supplied product information. Confirm that they describe the exact\n chemical form supplied, including any counterion or additional formulation\n ingredients, using the manufacturer's specification and batch documentation.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n No numerical purity is specified in the supplied description. Refer to the\n completed batch Certificate of Analysis for the tests performed, analytical\n methods, acceptance criteria and reported results.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n \u003c!--\n Publication checks:\n Chemical identity fields and the numerical mass are retained from the uploaded\n 5-AMINO-1MQ description; they have not been independently verified or replaced.\n No specific salt form, numerical purity, manufacturing location, storage\n temperature or additional ingredient has been inferred.\n\n The uploaded description states sterility, milling and sieving, additional\n preparative chromatographic purification for ULTIMATE, and more stringent\n endotoxin testing. Confirm these product-specific claims against the relevant\n manufacturing records and completed batch documentation before publication.\n Layout reference files are not evidence of these processes or batch results.\n --\u003e\n\n \u003csection class=\"ultimate-research-grade\" aria-labelledby=\"ultimate-5-amino-1mq-heading\" style=\"box-sizing: border-box; width: 100%; margin: 32px 0; font-family: Arial, Helvetica, sans-serif;\"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 28px;\n background-color: #080808;\n background-image: linear-gradient(135deg, #020202 0%, #090909 25%, #1c1c1c 56%, #101010 77%, #030303 100%);\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow: 0 16px 36px rgba(0, 0, 0, 0.25), inset 0 1px 0 rgba(255, 239, 170, 0.08);\n \"\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n pointer-events: none;\n background: radial-gradient(circle, rgba(255, 230, 139, 0.22) 0%, rgba(212, 175, 55, 0.08) 35%, rgba(212, 175, 55, 0) 73%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background: linear-gradient(90deg, transparent 0%, #d4af37 24%, #ffeea9 50%, #d4af37 76%, transparent 100%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n\n \u003cdiv style=\"\n display: inline-block;\n box-sizing: border-box;\n max-width: 100%;\n margin: 0 0 18px;\n padding: 8px 14px;\n color: #f7df88;\n background-color: rgba(212, 175, 55, 0.09);\n border: 1px solid rgba(247, 223, 136, 0.65);\n border-radius: 999px;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 1.4px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch3 id=\"ultimate-5-amino-1mq-heading\" style=\"margin: 0; color: #ffffff; font-size: 26px; font-weight: 700; line-height: 1.25;\"\u003e\n \u003cspan style=\"color: #f4d978; text-shadow: 0 0 18px rgba(212, 175, 55, 0.23);\"\u003eULTIMATE\u003c\/span\u003e\n \u003cspan style=\"display: inline-block; max-width: 100%; color: #ffffff;\"\u003e5-AMINO-1MQ\u003c\/span\u003e\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 10px 0 0; color: #f0d77d; font-size: 15px; font-weight: 700; line-height: 1.6; letter-spacing: 0.5px;\"\u003e\n Additional chromatographic purification and more stringent endotoxin testing\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"height: 1px; margin: 24px 0; background: linear-gradient(90deg, transparent, #d4af37, #f7df88, #d4af37, transparent);\"\u003e\u003c\/div\u003e\n\n \u003cp style=\"margin: 0; color: #f1f1f1; font-size: 15px; line-height: 1.8;\"\u003e\n The \u003cstrong style=\"color: #f7df88;\"\u003eULTIMATE 5-AMINO-1MQ specification\u003c\/strong\u003e\n is intended for laboratories requiring an additional preparative high-performance\n liquid chromatography purification stage beyond the Regular process, together\n with a more stringent bacterial endotoxin testing specification for\n lipopolysaccharides. Confirm the applicable specification and supporting\n manufacturing and analytical records for the selected grade and batch.\n \u003c\/p\u003e\n\n \u003cdiv style=\"display: flex; flex-wrap: wrap; gap: 14px; margin: 26px 0;\"\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Additional Purification\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n The stated specification includes a further preparative high-performance\n liquid chromatography stage after standard production and purification,\n designed to reduce residual process-related impurities.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n More Stringent Endotoxin Testing\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n The stated specification includes a more stringent bacterial endotoxin\n testing protocol. Refer to the batch records for the analytical method,\n acceptance criteria and reported results.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Batch-Specific Documentation\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n Supporting ULTIMATE records are provided where available. Confirm which\n tests were performed and match the completed documentation to 5-AMINO-1MQ,\n the selected specification and the batch number.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003c\/div\u003e\n\n \u003cdiv style=\"padding: 18px 20px; background-color: rgba(212, 175, 55, 0.05); border: 1px solid rgba(255, 255, 255, 0.08); border-left: 4px solid #d4af37; border-radius: 8px;\"\u003e\n \u003ch4 style=\"margin: 0 0 8px; color: #f7df88; font-size: 15px; line-height: 1.4;\"\u003e\n Regular or ULTIMATE?\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #e5e5e5; font-size: 14px; line-height: 1.75;\"\u003e\n \u003cstrong style=\"color: #ffffff;\"\u003eOur Regular 5-AMINO-1MQ remains a suitable choice for routine laboratory work\u003c\/strong\u003e\n where its documented specification meets the requirements of the intended\n method. Select ULTIMATE where the additional purification stage and more\n stringent endotoxin specification are required by your laboratory procedure.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"margin: 20px 0 0; color: #cccccc; font-size: 14px; line-height: 1.7;\"\u003e\n \u003cstrong style=\"color: #f7df88;\"\u003eSpecification note:\u003c\/strong\u003e\n The ULTIMATE designation does not, by itself, establish a numerical purity,\n an endotoxin limit or sterility. Use the applicable batch documentation to\n assess these requirements. The research-only restrictions above apply to both grades.\n \u003c\/p\u003e\n\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"product-format-5amino\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"product-format-5amino\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Product Format and Laboratory Preparation\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eLaboratory presentation:\u003c\/strong\u003e\n The supplied product specification describes sterile, lyophilised powder in\n sterile flip-top headspace vials, with milling and sieving to support consistent\n handling. Confirm the processing and sterility specifications against the\n relevant manufacturing and batch records before relying on them for a\n laboratory procedure.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eReconstitution:\u003c\/strong\u003e\n The supplied product information specifies bacteriostatic water containing\n 0.9% benzyl alcohol, or another suitable laboratory solvent appropriate to\n the intended analytical procedure. Confirm solvent compatibility with the\n exact supplied formulation and your laboratory's validated method.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n Follow the product-specific instructions for laboratory handling, storage\n and disposal. Consult the Safety Data Sheet and applicable batch documentation\n before preparing the material.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"documentation-delivery-5amino\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"documentation-delivery-5amino\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Documentation and Delivery\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eCertificate of Analysis:\u003c\/strong\u003e\n Batch-specific documentation is available where supplied. Scan the code on\n the product packaging, where provided for the applicable batch, or contact\n Research Scientific for the available certificate. Check that the document\n identifies 5-AMINO-1MQ, the selected grade and the batch number.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eSafety Data Sheet:\u003c\/strong\u003e\n Supplied to support appropriate laboratory handling, storage and regulatory\n compliance. Contact Research Scientific for the current document applicable\n to the exact material and formulation supplied.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eSupplier documentation:\u003c\/strong\u003e\n Supporting supplier records are reviewed where supplied. Use the applicable\n product specification and batch records to assess the material against your\n laboratory's requirements.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n \u003cstrong\u003eTracked delivery:\u003c\/strong\u003e\n Securely packaged for fast, reliable and trackable delivery, with insulated\n packaging used where required by the applicable transport specification.\n \u003c\/p\u003e\n\n \u003c!--\n No product-specific Certificate of Analysis or Safety Data Sheet addresses\n were supplied in the uploaded HTML. Documentation-on-request wording is\n retained. No product code, placeholder link or document address is invented.\n --\u003e\n \u003c\/section\u003e\n\n\u003c\/div\u003e","brand":"peptidestore","offers":[{"title":"2mg","offer_id":50017649721682,"sku":"PEP001","price":60.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50017649754450,"sku":"PEP001R","price":125.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50017649787218,"sku":"PEP001R","price":232.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50017649819986,"sku":"PEP001R","price":431.5,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50017649852754,"sku":"PEP001R","price":994.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51234880651602,"sku":"PEP001R","price":518.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51234881667410,"sku":"PEP001R","price":1035.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51234882093394,"sku":"PEP001R","price":908.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51234882781522,"sku":"PEP001R","price":1854.96,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54536218968402,"sku":"PEP001U","price":174.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54536219001170,"sku":"PEP001U","price":325.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54536219033938,"sku":"PEP001U","price":603.25,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54536219066706,"sku":"PEP001U","price":1392.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54536219099474,"sku":"PEP001U","price":725.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54536219132242,"sku":"PEP001U","price":1391.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54536219197778,"sku":"PEP001U","price":1353.5,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766533443922,"sku":"PEP001U","price":2705.95,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-5-amino-1mq-research-peptide-ultra-pure-powder.png?v=1767865388"},{"product_id":"buy-ace-031-uk","title":"Ace 031 – Research Grade Peptide","description":"\u003ch3 id=\"ace031researchgraderecombinantfusionprotein\"\u003e\n \u003cstrong\u003e\n ACE-031\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Recombinant Fusion Protein\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003c\/p\u003e\u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n \n\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade recombinant protein with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied in sealed flip-top headspace vials designed for controlled laboratory use\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our specialised research proteins and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling. The stated weight refers to the contents of a single vial. Where reconstitution is required, the solvent, buffer, concentration, handling and storage instructions stated in the applicable batch documentation should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-ace031-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 30px 0;\n font-family: Arial, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 34px;\n background: linear-gradient(\n 135deg,\n #030303 0%,\n #111111 42%,\n #1b1b1b 65%,\n #070707 100%\n );\n border: 1px solid #d4af37;\n border-radius: 16px;\n box-shadow:\n 0 18px 42px rgba(0, 0, 0, 0.34),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 0 28px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -115px;\n right: -85px;\n width: 315px;\n height: 315px;\n border-radius: 50%;\n background: radial-gradient(\n circle,\n rgba(247, 223, 136, 0.22) 0%,\n rgba(212, 175, 55, 0.10) 34%,\n rgba(212, 175, 55, 0) 72%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -150px;\n left: -110px;\n width: 320px;\n height: 320px;\n border-radius: 50%;\n background: radial-gradient(\n circle,\n rgba(212, 175, 55, 0.13) 0%,\n rgba(212, 175, 55, 0.04) 42%,\n rgba(212, 175, 55, 0) 74%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 17px;\n padding: 8px 14px;\n color: #f7df88;\n background: rgba(212, 175, 55, 0.08);\n border: 1px solid rgba(247, 223, 136, 0.75);\n border-radius: 999px;\n box-shadow:\n inset 0 0 12px rgba(212, 175, 55, 0.05),\n 0 4px 14px rgba(0, 0, 0, 0.22);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.7px;\n text-transform: uppercase;\n \"\u003e\n Premium Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-ace031-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f3d67a;\n text-shadow:\n 0 0 16px rgba(212, 175, 55, 0.20),\n 0 1px 0 rgba(255, 255, 255, 0.08);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n ACE-031\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 10px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.65;\n letter-spacing: 0.2px;\n \"\u003e\n Enhanced chromatographic purification and more stringent bacterial endotoxin testing for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 24px 0;\n background: linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.80) 18%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.80) 82%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f0f0f0;\n font-size: 15px;\n line-height: 1.78;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE ACE-031 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of purification and quality control. Following the standard production and purification process, the finished research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 13px;\n width: 100%;\n margin: 25px 0;\n \"\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 195px;\n min-width: 0;\n padding: 19px;\n background: linear-gradient(\n 145deg,\n rgba(32, 32, 32, 0.96),\n rgba(10, 10, 10, 0.98)\n );\n border: 1px solid rgba(212, 175, 55, 0.42);\n border-radius: 10px;\n box-shadow:\n 0 8px 19px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.025);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.35;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.6;\n \"\u003e\n A further preparative HPLC purification stage is completed after the standard purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 195px;\n min-width: 0;\n padding: 19px;\n background: linear-gradient(\n 145deg,\n rgba(32, 32, 32, 0.96),\n rgba(10, 10, 10, 0.98)\n );\n border: 1px solid rgba(212, 175, 55, 0.42);\n border-radius: 10px;\n box-shadow:\n 0 8px 19px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.025);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.35;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.6;\n \"\u003e\n Subject to the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 195px;\n min-width: 0;\n padding: 19px;\n background: linear-gradient(\n 145deg,\n rgba(32, 32, 32, 0.96),\n rgba(10, 10, 10, 0.98)\n );\n border: 1px solid rgba(212, 175, 55, 0.42);\n border-radius: 10px;\n box-shadow:\n 0 8px 19px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.025);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.35;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Option\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.6;\n \"\u003e\n Intended for laboratory projects requiring the additional purification and testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 18px 20px;\n background: rgba(255, 255, 255, 0.035);\n border-top: 1px solid rgba(255, 255, 255, 0.075);\n border-right: 1px solid rgba(255, 255, 255, 0.075);\n border-bottom: 1px solid rgba(255, 255, 255, 0.075);\n border-left: 4px solid #d4af37;\n border-radius: 7px;\n box-shadow: inset 0 0 18px rgba(255, 255, 255, 0.012);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 6px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.68;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade ACE-031 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of quality, documentation and value. ULTIMATE is intended for projects where the additional HPLC purification stage and more stringent bacterial endotoxin and LPS testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 19px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.6;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE ACE-031 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Product specifications and analytical results are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"ace031scientificinformation\"\u003e\n \u003cstrong\u003eScientific and Chemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eMaterial Type:\u003c\/strong\u003e\n Recombinant fusion protein\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStructural Description:\u003c\/strong\u003e\n Soluble extracellular domain of human activin receptor type IIB fused to the Fc region of human immunoglobulin G1\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCommon Scientific Description:\u003c\/strong\u003e\n ActRIIB-Fc fusion protein\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIUPAC Name:\u003c\/strong\u003e\n Not applicable to a recombinant glycoprotein\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n Refer to the applicable supplier and batch documentation; the product identity must be confirmed against the material supplied\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n Not represented by a single fixed molecular formula because recombinant protein glycosylation and other post-translational characteristics may be batch-dependent\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Weight:\u003c\/strong\u003e\n Batch, expression-system and glycosylation dependent; refer to the applicable Certificate of Analysis and analytical characterisation\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✅ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✅ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✅ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✅ Supplier documentation – Reviewed where supporting identity and analytical records are supplied.\n \u003cbr\u003e\n\n ✅ Analytical documentation – Product-specific analytical results are provided where available for the applicable batch.\n \u003cbr\u003e\n\n ✅ Fast, reliable and trackable delivery – Securely packaged and dispatched in insulated packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"ace031productoverview\"\u003e\n \u003cstrong\u003eACE-031 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eACE-031 research-grade recombinant protein\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development and exploratory research workflows. The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. The Regular specification is highly suitable for the majority of routine laboratory work, while the premium ULTIMATE option provides an additional HPLC purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP002.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP002.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50017688977746,"sku":"PEP002R","price":116.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50017689010514,"sku":"PEP002R","price":270.25,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50017689043282,"sku":"PEP002R","price":504.85,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50017689076050,"sku":"PEP002R","price":936.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50017689108818,"sku":"PEP002R","price":2158.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51241886875986,"sku":"PEP002R","price":1123.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51241895133522,"sku":"PEP002R","price":2248.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51241918955858,"sku":"PEP002R","price":2098.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51241920266578,"sku":"PEP002R","price":4196.85,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648344281426,"sku":"PEP000U","price":378.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648344314194,"sku":"PEP000U","price":705.5,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648344346962,"sku":"PEP000U","price":1310.5,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648344379730,"sku":"PEP000U","price":3021.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648344412498,"sku":"PEP000U","price":1573.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648344445266,"sku":"PEP002U","price":3147.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648344510802,"sku":"PEP002U","price":2938.5,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766533378386,"sku":"PEP002U","price":5875.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-ace-031-uk-pure-fine-peptide-powder.png?v=1767865429"},{"product_id":"buy-adipotide-peptide-uk","title":"ADIPOTIDE (FTPP) - Research Grade Peptide","description":"\u003cdiv class=\"research-scientific-product-description\" style=\"box-sizing: border-box; width: 100%; max-width: 100%; min-width: 0; font-family: Arial, Helvetica, sans-serif; font-size: 15px; line-height: 1.7; color: #222222; overflow-wrap: anywhere;\"\u003e\n\n \u003ch3 id=\"adipotide-ftpp-research-grade-peptide\" style=\"margin: 0 0 18px; color: #00455f; font-size: 20px; line-height: 1.35;\"\u003e\n ADIPOTIDE (FTPP) – Research Grade Peptide\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n \u003cul style=\"margin: 0 0 20px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eResearch-grade ADIPOTIDE (FTPP) supplied exclusively for laboratory use.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eSupplied as lyophilised powder in flip-top headspace vials.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eProduct-specific batch documentation available where supplied.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n The stated quantity applies to an individual vial unless the selected product option\n expressly identifies a multi-vial laboratory pack. Refer to the product label and\n applicable batch documentation for the declared peptide content, formulation and\n any additional ingredients.\n \u003c\/p\u003e\n\n \u003ch3 id=\"adipotide-ftpp-chemical-information\" style=\"margin: 28px 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n Chemical Information\n \u003c\/h3\u003e\n\n \u003cul style=\"margin: 0 0 18px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eProduct name:\u003c\/strong\u003e ADIPOTIDE (FTPP).\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eSynonym in the supplied description:\u003c\/strong\u003e\n Da-74204; requires manufacturer confirmation.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eChemical Abstracts Service registry number, as supplied:\u003c\/strong\u003e\n 859216-15-2.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eMolecular formula, as supplied:\u003c\/strong\u003e\n C\u003csub\u003e111\u003c\/sub\u003eH\u003csub\u003e206\u003c\/sub\u003eN\u003csub\u003e36\u003c\/sub\u003eO\u003csub\u003e28\u003c\/sub\u003eS\u003csub\u003e2\u003c\/sub\u003e.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eApproximate molecular mass in the supplied description:\u003c\/strong\u003e\n 2,554 daltons; subject to the clarification below.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003ePhysical presentation:\u003c\/strong\u003e Lyophilised laboratory powder.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003ePurity specification:\u003c\/strong\u003e\n No numerical purity is specified in the supplied description. Refer to a completed,\n batch-specific Certificate of Analysis for the analytical method, acceptance criterion\n and reported result.\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eChemical-information clarification:\u003c\/strong\u003e\n The stated formula gives a calculated average molar mass of approximately\n 2,557.2 grams per mole. This is a formula-based calculation, not a batch measurement,\n and has not been reconciled with the supplied approximate mass of 2,554 daltons.\n Confirm the formula, structural form and mass convention against the manufacturer's\n specification before relying on either value.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n The supplied registry number and formula are also listed in the product's Safety\n Data Sheet, which does not provide a molecular mass or confirm the synonym Da-74204.\n These catalogue details do not establish the identity, purity or complete formulation\n of the supplied batch. Refer to the manufacturer's specification and completed batch\n documentation for the exact material and any additional ingredients.\n \u003c\/p\u003e\n\n \u003c!--\n Publication checks, reviewed 10 September 2026:\n\n The current source and the PEP007 Safety Data Sheet both specify registry number\n 859216-15-2 and formula C111H206N36O28S2. These supplied fields are retained;\n no alternative identity, formula, sequence or salt form has been substituted.\n The supplied synonym Da-74204 requires manufacturer confirmation. It is not\n listed in the linked Safety Data Sheet, which gives no molecular mass.\n\n The source's approximate molecular mass of 2554 daltons is retained and flagged.\n The separate average molar mass calculation uses abridged standard atomic weights:\n (111 x 12.011) + (206 x 1.0080) + (36 x 14.007) +\n (28 x 15.999) + (2 x 32.06) = 2557.213 grams per mole.\n This calculation does not verify the supplied formula or any batch result.\n Atomic-weight reference:\n https:\/\/ciaaw.org\/abridged-atomic-weights.htm\n Product-specific source record:\n https:\/\/researchscientific.co.uk\/msds\/PEP007.pdf\n\n The ULTIMATE panel describes the established range specification conditionally.\n Confirm that additional purification, more stringent endotoxin testing and grade\n availability apply to ADIPOTIDE (FTPP), supported by product-specific records.\n No numerical purity, endotoxin limit or sterility result has been inferred.\n --\u003e\n\n \u003csection class=\"ultimate-research-grade\" aria-labelledby=\"ultimate-adipotide-ftpp-heading\" style=\"box-sizing: border-box; width: 100%; margin: 32px 0; font-family: Arial, Helvetica, sans-serif;\"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 28px;\n background-color: #080808;\n background-image: linear-gradient(135deg, #020202 0%, #090909 25%, #1c1c1c 56%, #101010 77%, #030303 100%);\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow: 0 16px 36px rgba(0, 0, 0, 0.25), inset 0 1px 0 rgba(255, 239, 170, 0.08);\n \"\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n pointer-events: none;\n background: radial-gradient(circle, rgba(255, 230, 139, 0.22) 0%, rgba(212, 175, 55, 0.08) 35%, rgba(212, 175, 55, 0) 73%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background: linear-gradient(90deg, transparent 0%, #d4af37 24%, #ffeea9 50%, #d4af37 76%, transparent 100%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n\n \u003cdiv style=\"\n display: inline-block;\n box-sizing: border-box;\n max-width: 100%;\n margin: 0 0 18px;\n padding: 8px 14px;\n color: #f7df88;\n background-color: rgba(212, 175, 55, 0.09);\n border: 1px solid rgba(247, 223, 136, 0.65);\n border-radius: 999px;\n font-size: 11px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 1.4px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch3 id=\"ultimate-adipotide-ftpp-heading\" style=\"margin: 0; color: #ffffff; font-size: 30px; font-weight: 700; line-height: 1.25;\"\u003e\n \u003cspan style=\"color: #f4d978; text-shadow: 0 0 18px rgba(212, 175, 55, 0.23);\"\u003eULTIMATE\u003c\/span\u003e\n \u003cspan style=\"display: inline-block; max-width: 100%; color: #ffffff;\"\u003eADIPOTIDE (FTPP)\u003c\/span\u003e\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 10px 0 0; color: #f0d77d; font-size: 13px; font-weight: 700; line-height: 1.6; letter-spacing: 0.5px;\"\u003e\n Additional chromatographic purification and more stringent endotoxin testing\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"height: 1px; margin: 24px 0; background: linear-gradient(90deg, transparent, #d4af37, #f7df88, #d4af37, transparent);\"\u003e\u003c\/div\u003e\n\n \u003cp style=\"margin: 0; color: #f1f1f1; font-size: 15px; line-height: 1.8;\"\u003e\n The \u003cstrong style=\"color: #f7df88;\"\u003eULTIMATE range\u003c\/strong\u003e is intended for\n laboratories requiring an additional preparative high-performance liquid\n chromatography purification stage beyond the Regular process, together with\n a more stringent bacterial endotoxin testing specification for lipopolysaccharides.\n For ADIPOTIDE (FTPP), confirm that the selected ULTIMATE grade and batch are supported\n by the relevant manufacturing and analytical records.\n \u003c\/p\u003e\n\n \u003cdiv style=\"display: flex; flex-wrap: wrap; gap: 14px; margin: 26px 0;\"\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 13px; font-weight: 700; line-height: 1.5;\"\u003e\n Additional Purification\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 13px; line-height: 1.7;\"\u003e\n Review the product-specific record of the additional preparative\n high-performance liquid chromatography stage beyond the Regular\n purification process.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 13px; font-weight: 700; line-height: 1.5;\"\u003e\n More Stringent Endotoxin Testing\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 13px; line-height: 1.7;\"\u003e\n Confirm the analytical method, acceptance criteria and reported results\n against the applicable ULTIMATE bacterial endotoxin specification.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 13px; font-weight: 700; line-height: 1.5;\"\u003e\n Batch-Specific Documentation\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 13px; line-height: 1.7;\"\u003e\n Match the manufacturer's specification and completed analytical records\n to ADIPOTIDE (FTPP), the selected grade and the batch number.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003c\/div\u003e\n\n \u003cdiv style=\"padding: 18px 20px; background-color: rgba(212, 175, 55, 0.05); border: 1px solid rgba(255, 255, 255, 0.08); border-left: 4px solid #d4af37; border-radius: 8px;\"\u003e\n \u003ch4 style=\"margin: 0 0 8px; color: #f7df88; font-size: 15px; line-height: 1.4;\"\u003e\n Regular or ULTIMATE?\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #e5e5e5; font-size: 14px; line-height: 1.75;\"\u003e\n \u003cstrong style=\"color: #ffffff;\"\u003eOur Regular ADIPOTIDE (FTPP) remains a suitable choice for routine laboratory work\u003c\/strong\u003e\n where its documented specification meets the requirements of the intended\n method. Select ULTIMATE where the documented additional purification stage\n and more stringent endotoxin specification are required by your laboratory\n procedure.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"margin: 20px 0 0; color: #cccccc; font-size: 12px; line-height: 1.7;\"\u003e\n \u003cstrong style=\"color: #f7df88;\"\u003eFor research use only.\u003c\/strong\u003e\n The ULTIMATE designation does not, by itself, establish a numerical purity,\n an endotoxin limit or sterility. Confirm the relevant specification and results\n in the batch documentation. Neither grade is intended for human or animal use.\n \u003c\/p\u003e\n\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/section\u003e\n\n \u003ch3 style=\"margin: 28px 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n Formulation Process and Quality Assurance\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eProduct specification:\u003c\/strong\u003e\n Review the applicable manufacturer and analytical records for the material's identity,\n declared content, formulation and quality requirements. Match the documentation to\n ADIPOTIDE (FTPP), the selected grade and the batch number.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n \u003cstrong\u003eSupplier documentation:\u003c\/strong\u003e\n Supplier records are reviewed where supplied. Assess the tests performed and reported\n results against the documented analytical methods and acceptance criteria, rather than\n relying on a grade name alone.\n \u003c\/p\u003e\n\n \u003ch3 style=\"margin: 28px 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n Laboratory Handling and Reconstitution\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n The supplied description identifies the powder and vials as sterile and states that\n the lyophilised powder has been finely milled and sieved. Confirm these processing\n and sterility claims against the relevant manufacturing and batch records before\n relying on them for a laboratory procedure.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n The supplied product information identifies bacteriostatic water containing 0.9% benzyl\n alcohol, or a suitable equivalent, as the reconstitution medium. Confirm that the\n selected medium, concentration and handling conditions are compatible with the exact\n supplied formulation and your laboratory's validated procedure.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n Follow the product-specific handling, storage and disposal instructions. Research Scientific\n does not provide advice or recommendations regarding dosage, administration or use in\n humans or animals.\n \u003c\/p\u003e\n\n \u003ch3 style=\"margin: 28px 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n Batch Documentation and Delivery\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eDocumentation access:\u003c\/strong\u003e\n Scan the code on the packaging, where provided, or use the product-document links below.\n Consult the current, product-specific Safety Data Sheet to support laboratory risk\n assessment, safe handling, storage and disposal. See Product Documentation below\n for the status of the linked Certificate of Analysis.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n \u003cstrong\u003eTracked delivery:\u003c\/strong\u003e\n Securely packaged and dispatched frozen in insulated packaging using a tracked\n delivery service. Follow the product's storage instructions upon receipt.\n \u003c\/p\u003e\n\n \u003chr style=\"border: 0; border-top: 1px solid #dddddd; margin: 26px 0;\"\u003e\n\n \u003ch3 style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n ADIPOTIDE (FTPP) Product Overview\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n Research Scientific supplies ADIPOTIDE (FTPP) as a lyophilised research-grade peptide for\n controlled laboratory handling and analytical work. Review the declared composition\n and completed batch documentation to select a specification appropriate to your\n laboratory's requirements.\n \u003c\/p\u003e\n\n \u003ch3 style=\"margin: 28px 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n Product Documentation\n \u003c\/h3\u003e\n\n \u003c!--\n Both PEP007 document addresses are retained from the supplied HTML.\n When checked on 10 September 2026, the Certificate of Analysis displayed an\n uncompleted template, with no populated product identity, batch number or results.\n It has not been used to substantiate analytical, purity or ULTIMATE claims.\n Replace or complete the document and update the visible wording when verified\n ADIPOTIDE (FTPP) batch documentation is available.\n\n The linked Safety Data Sheet identifies ADIPOTIDE (FTPP), product code PEP007,\n registry number 859216-15-2 and formula C111H206N36O28S2. Its revision date is\n 9 February 2025. It does not resolve the synonym or molecular-mass queries.\n --\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP007.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n View Certificate of Analysis template\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n The linked document currently displays an uncompleted certificate template.\n Contact Research Scientific for a completed ADIPOTIDE (FTPP) certificate identifying the\n actual product, selected grade and batch before relying on reported analytical results.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP007.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n View ADIPOTIDE (FTPP) Safety Data Sheet\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n Confirm that the Safety Data Sheet matches the exact material and formulation supplied.\n Request an updated document where the product identity or specification requires clarification.\n \u003c\/p\u003e\n\n\u003c\/div\u003e","brand":"peptidestore","offers":[{"title":"2mg","offer_id":50021200691538,"sku":"PEP007","price":14.85,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021200724306,"sku":"PEP007","price":33.5,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021200757074,"sku":"PEP007","price":61.85,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021200789842,"sku":"PEP007","price":113.5,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021200822610,"sku":"PEP007","price":259.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51242029220178,"sku":"PEP007","price":135.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51242030170450,"sku":"PEP007","price":270.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51242031415634,"sku":"PEP007","price":252.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51242032365906,"sku":"PEP007","price":504.85,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656982057298,"sku":"PEP007U","price":47.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656982090066,"sku":"PEP007U","price":88.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656982122834,"sku":"PEP007U","price":163.5,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656982155602,"sku":"PEP007U","price":376.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656982188370,"sku":"PEP007U","price":196.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656982221138,"sku":"PEP007U","price":391.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656982286674,"sku":"PEP007U","price":365.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766533149010,"sku":"PEP007U","price":730.95,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-adipotide-peptide-uk-ultra-pure-research-grade.png?v=1767887054"},{"product_id":"buy-alarelin-peptide-uk","title":"ALARELIN - Research Grade Peptide","description":"\u003ch3 id=\"alarelin-research-grade-synthetic-nonapeptide\"\u003e\n \u003cstrong\u003e\n ALARELIN\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Synthetic Nonapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n\n \u003c\/p\u003e\u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n \n\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic nonapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared alarelin content of a single vial, subject to the applicable batch documentation. Where reconstitution or dissolution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-alarelin-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #0a0a0a 27%,\n #1c1c1c 56%,\n #101010 76%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-alarelin-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n ALARELIN\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Purification and Endotoxin Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE Alarelin range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM DOCUMENTATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade Alarelin product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE Alarelin remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, purity, peptide content, counter-ion content, endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"alarelin-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n Alarelin\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCommon Supplied Form:\u003c\/strong\u003e\n Alarelin diacetate, where confirmed by the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic modified nonapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Descriptions:\u003c\/strong\u003e\n Alarelin acetate; des-Gly\u003csup\u003e10\u003c\/sup\u003e-[D-Ala\u003csup\u003e6\u003c\/sup\u003e]-gonadorelin ethylamide; [D-Ala\u003csup\u003e6\u003c\/sup\u003e, des-Gly\u003csup\u003e10\u003c\/sup\u003e]-GnRH ethylamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n pGlu-His-Trp-Ser-Tyr-D-Ala-Leu-Arg-Pro-NHEt\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Nine amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Modification:\u003c\/strong\u003e\n Pyroglutamic acid\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidue Modification:\u003c\/strong\u003e\n D-alanine at position 6\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Modification:\u003c\/strong\u003e\n Proline ethylamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 79561-22-1\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUncountered Peptide Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e56\u003c\/sub\u003eH\u003csub\u003e78\u003c\/sub\u003eN\u003csub\u003e16\u003c\/sub\u003eO\u003csub\u003e12\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUncountered Peptide Molecular Weight:\u003c\/strong\u003e\n Approximately 1167.32 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlarelin Diacetate Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e56\u003c\/sub\u003eH\u003csub\u003e78\u003c\/sub\u003eN\u003csub\u003e16\u003c\/sub\u003eO\u003csub\u003e12\u003c\/sub\u003e\n · 2C\u003csub\u003e2\u003c\/sub\u003eH\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e2\u003c\/sub\u003e,\n equivalent to C\u003csub\u003e60\u003c\/sub\u003eH\u003csub\u003e86\u003c\/sub\u003eN\u003csub\u003e16\u003c\/sub\u003eO\u003csub\u003e16\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlarelin Diacetate Molecular Weight:\u003c\/strong\u003e\n Approximately 1287.42 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Confirmation:\u003c\/strong\u003e\n The number and identity of acetate counter-ions should be confirmed using the applicable batch documentation, as this affects the molecular formula, formula weight and net peptide content\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✅ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✅ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✅ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✅ Identity documentation – Peptide sequence, molecular identity and supplied chemical form should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✅ Purity documentation – The reported purity specification applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✅ Counter-ion documentation – Acetate content and net peptide content should be interpreted using the applicable analytical documentation.\n \u003cbr\u003e\n\n ✅ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✅ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-controlled packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"alarelin-product-overview\"\u003e\n \u003cstrong\u003eAlarelin Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eAlarelin research-grade synthetic nonapeptide\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation and exploratory biochemical research workflows. The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Peptide identity, sequence, purity, supplied salt form, counter-ion content, net peptide content and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine laboratory investigations, the Regular Alarelin specification remains highly suitable. The premium black-and-gold ULTIMATE Alarelin option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP009.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP009.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"peptidestore","offers":[{"title":"2mg","offer_id":50021261508946,"sku":"PEP009","price":19.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021261541714,"sku":"PEP009","price":44.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021261574482,"sku":"PEP009","price":81.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021261607250,"sku":"PEP009","price":150.5,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021261640018,"sku":"PEP009","price":346.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51242061332818,"sku":"PEP009","price":180.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51242061988178,"sku":"PEP009","price":360.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51242064445778,"sku":"PEP009","price":336.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51242065723730,"sku":"PEP009","price":672.25,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656981598546,"sku":"PEP009U","price":63.85,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656981631314,"sku":"PEP009U","price":117.95,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656981664082,"sku":"PEP009U","price":218.5,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656981696850,"sku":"PEP009U","price":502.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656981729618,"sku":"PEP009U","price":261.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656981762386,"sku":"PEP009U","price":522.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656981827922,"sku":"PEP009U","price":488.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766533083474,"sku":"PEP009U","price":975.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-alarelin-peptide-uk-pure-fine-powder.png?v=1767865428"},{"product_id":"aod-9604-peptide-uk","title":"AOD 9604 - Research Grade Peptide","description":"\u003ch3 id=\"aod-9604-research-grade-cyclic-hexadecapeptide\"\u003e\n \u003cstrong\u003e\n AOD-9604\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Cyclic Hexadecapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic cyclic hexadecapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined 16-residue peptide sequence containing an intramolecular disulphide bridge\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared AOD-9604 content of a single vial, subject to the applicable batch documentation. Where reconstitution or dissolution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-aod-9604-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 26%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-aod-9604-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n AOD-9604\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Peptide Purification and Endotoxin Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE AOD-9604 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM RESEARCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade AOD-9604 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for research projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE AOD-9604 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, purity, sequence, disulphide-bond integrity, peptide content, counter-ion content, endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"aod-9604-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n AOD-9604\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Name:\u003c\/strong\u003e\n AOD9604\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Peptide Description:\u003c\/strong\u003e\n Tyr-hGH(177–191)\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic cyclic hexadecapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 16 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n Tyr-Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser-Cys-Gly-Phe\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n YLRIVQCRSVEGSCGF\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStructural Modification:\u003c\/strong\u003e\n Intramolecular disulphide bridge between cysteine residues 7 and 14\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Additional tyrosine residue preceding the 15-residue human growth hormone 177–191 fragment\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSystematic Peptide Name:\u003c\/strong\u003e\n L-tyrosyl-L-leucyl-L-arginyl-L-isoleucyl-L-valyl-L-glutaminyl-L-cysteinyl-L-arginyl-L-seryl-L-valyl-L-alpha-glutamyl-glycyl-L-seryl-L-cysteinyl-glycyl-L-phenylalanine (7→14)-disulphide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number for AOD-9604 Free Base:\u003c\/strong\u003e\n 221231-10-3\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUNII Code:\u003c\/strong\u003e\n 7UP768IP4M\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Base Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e78\u003c\/sub\u003eH\u003csub\u003e123\u003c\/sub\u003eN\u003csub\u003e23\u003c\/sub\u003eO\u003csub\u003e23\u003c\/sub\u003eS\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Base Molecular Weight:\u003c\/strong\u003e\n Approximately 1815.09 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAOD-9604 Acetate Formula:\u003c\/strong\u003e\n C\u003csub\u003e78\u003c\/sub\u003eH\u003csub\u003e123\u003c\/sub\u003eN\u003csub\u003e23\u003c\/sub\u003eO\u003csub\u003e23\u003c\/sub\u003eS\u003csub\u003e2\u003c\/sub\u003e\n ·\n CH\u003csub\u003e3\u003c\/sub\u003eCOOH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAOD-9604 Acetate Molecular Weight:\u003c\/strong\u003e\n Approximately 1875.1 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The Certificate of Analysis should confirm whether the supplied material is AOD-9604 free base, AOD-9604 acetate or another counter-ion form, as this affects the molecular formula, formula weight and net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Clarification:\u003c\/strong\u003e\n AOD-9604 is derived from the C-terminal region of human growth hormone and is not a somatostatin fragment\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✅ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✅ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✅ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✅ Sequence documentation – Peptide sequence, molecular identity and disulphide-bond configuration should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✅ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✅ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water and counter-ion results.\n \u003cbr\u003e\n\n ✅ Counter-ion documentation – Acetate or other counter-ion content should be confirmed using the applicable analytical documentation.\n \u003cbr\u003e\n\n ✅ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✅ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-controlled packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"aod-9604-product-overview\"\u003e\n \u003cstrong\u003eAOD-9604 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eAOD-9604 research-grade cyclic hexadecapeptide\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation and exploratory biochemical research workflows. The defined peptide sequence contains 16 amino-acid residues and an intramolecular disulphide bridge between its two cysteine residues. The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Product identity, chromatographic purity, peptide content, chemical form, counter-ion content, water content, disulphide-bond integrity, residual solvents and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not be interpreted automatically as equivalent to net peptide content.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine laboratory investigations, the Regular AOD-9604 specification remains highly suitable. The premium black-and-gold ULTIMATE AOD-9604 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP010.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP010.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50021285757266,"sku":"PEP010","price":27.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021285790034,"sku":"PEP010","price":58.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021285822802,"sku":"PEP010","price":107.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021285855570,"sku":"PEP010","price":199.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021285888338,"sku":"PEP010","price":458.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51242079093074,"sku":"PEP010","price":239.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51242093314386,"sku":"PEP010","price":477.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51242097213778,"sku":"PEP010","price":446.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51242098917714,"sku":"PEP010","price":891.25,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656981041490,"sku":"PEP010U","price":83.5,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656981074258,"sku":"PEP010U","price":155.95,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656981107026,"sku":"PEP010U","price":288.25,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656981139794,"sku":"PEP010U","price":664.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656981172562,"sku":"PEP010U","price":346.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656981205330,"sku":"PEP010U","price":692.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656981270866,"sku":"PEP010U","price":646.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766533050706,"sku":"PEP010U","price":1292.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-aod-9604-peptide-uk-pure-fine-peptide-powder.png?v=1767865428"},{"product_id":"buy-bpc-157-peptide-uk","title":"BPC-157 - Research Grade Peptide","description":"\u003ch3 id=\"bpc-157-research-grade-synthetic-pentadecapeptide\"\u003e\n \u003cstrong\u003e\n BPC-157\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Synthetic Pentadecapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic pentadecapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined linear peptide comprising 15 amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared BPC-157 content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-bpc-157-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 26%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-bpc-157-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n BPC-157\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Peptide Purification and LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE BPC-157 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM RESEARCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade BPC-157 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for research projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE BPC-157 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, purity, peptide content, chemical form, counter-ion content, endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"bpc-157-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n BPC-157\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n BPC 157; Bepecin; PL-14736; PL-10; PLD-116\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic linear pentadecapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 15 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n GEPPPGKPADDAGLV\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Base CAS Number:\u003c\/strong\u003e\n 137525-51-0\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Base UNII:\u003c\/strong\u003e\n 8ED8NXK95P\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Base Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e62\u003c\/sub\u003eH\u003csub\u003e98\u003c\/sub\u003eN\u003csub\u003e16\u003c\/sub\u003eO\u003csub\u003e22\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Base Molecular Weight:\u003c\/strong\u003e\n Approximately 1419.54 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eBPC-157 Acetate CAS Number:\u003c\/strong\u003e\n 216441-37-1\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eBPC-157 Acetate UNII:\u003c\/strong\u003e\n PAR2FC72XP\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eBPC-157 Acetate Formula:\u003c\/strong\u003e\n C\u003csub\u003e62\u003c\/sub\u003eH\u003csub\u003e98\u003c\/sub\u003eN\u003csub\u003e16\u003c\/sub\u003eO\u003csub\u003e22\u003c\/sub\u003e\n ·\n x(C\u003csub\u003e2\u003c\/sub\u003eH\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e2\u003c\/sub\u003e)\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eBPC-157 Acetate Molecular Weight:\u003c\/strong\u003e\n Dependent upon the number and measured proportion of acetate counter-ions; refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is BPC-157 free base, BPC-157 acetate or another counter-ion form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Chromatographic purity, net peptide content, water content and counter-ion content are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – Peptide sequence and molecular identity should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water and counter-ion results.\n \u003cbr\u003e\n\n ✓ Counter-ion documentation – Acetate, trifluoroacetate or another counter-ion should be identified and quantified where applicable.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-controlled packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"bpc-157-product-overview\"\u003e\n \u003cstrong\u003eBPC-157 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eBPC-157 research-grade synthetic pentadecapeptide\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation and exploratory biochemical research workflows. The material comprises a defined linear sequence of 15 amino-acid residues and is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Product identity, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. A chromatographic purity result should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine laboratory investigations, the Regular BPC-157 specification remains highly suitable. The premium black-and-gold ULTIMATE BPC-157 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP014.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP014.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50021336482130,"sku":"PEP014","price":10.5,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021336514898,"sku":"PEP014","price":18.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021336547666,"sku":"PEP014","price":30.25,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021336580434,"sku":"PEP014","price":57.25,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021336613202,"sku":"PEP014","price":135.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51242281271634,"sku":"PEP014","price":75.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51242283794770,"sku":"PEP014","price":150.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51242287464786,"sku":"PEP014","price":125.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51242296279378,"sku":"PEP014","price":250.85,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648343069010,"sku":"PEP014U","price":26.95,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648343101778,"sku":"PEP014U","price":42.95,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648343134546,"sku":"PEP014U","price":80.95,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648343167314,"sku":"PEP014U","price":189.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648343200082,"sku":"PEP014U","price":105.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648343232850,"sku":"PEP014U","price":210.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648343298386,"sku":"PEP014U","price":175.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766532919634,"sku":"PEP014U","price":350.85,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-bpc-157-peptide-uk-pure-fine-powder.png?v=1767887056"},{"product_id":"cjc-1295-research-peptide-uk","title":"CJC-1295 - Research Grade Peptide","description":"\u003ch3 id=\"cjc-1295-research-grade-peptide\"\u003e\n \u003cstrong\u003e\n CJC-1295\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research Grade Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic CJC-1295 peptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined 30-residue modified peptide structure\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared CJC-1295 peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-cjc-1295-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-cjc-1295-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n CJC-1295\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Peptide Purification and LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE CJC-1295 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished CJC-1295 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM RESEARCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade CJC-1295 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for research projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE CJC-1295 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, purity, peptide content, molecular form, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"cjc-1295-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n CJC-1295\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic modified 30-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStructural Description:\u003c\/strong\u003e\n Tetrasubstituted human growth hormone-releasing factor 1–29 analogue containing an additional C-terminal lysine bearing an N\u003csup\u003eε\u003c\/sup\u003e-3-maleimidopropionyl modification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 30 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eModified Residue:\u003c\/strong\u003e\n The side chain of the additional C-terminal lysine is modified with a 3-maleimidopropionyl group\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Substitutions:\u003c\/strong\u003e\n D-alanine at position 2, glutamine at position 8, alanine at position 15 and leucine at position 27\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Modified lysinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 446262-90-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n 91971820\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUNII:\u003c\/strong\u003e\n 62RC32V9N7\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e165\u003c\/sub\u003eH\u003csub\u003e269\u003c\/sub\u003eN\u003csub\u003e47\u003c\/sub\u003eO\u003csub\u003e46\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 3647.2 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eProduct Distinction:\u003c\/strong\u003e\n This CJC-1295 listing contains the C-terminal maleimidopropionyl-lysine modification. The separate product listed as CJC-1295 Without DAC does not contain this modification and has a different molecular formula and molecular weight.\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion or Salt Form:\u003c\/strong\u003e\n Refer to the applicable Certificate of Analysis, as acetate, trifluoroacetate or another counter-ion may affect net peptide content and the measured mass of the supplied material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Chromatographic purity, net peptide content, molecular identity, water content, residual solvent content and counter-ion content are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – Peptide sequence, residue substitutions and the C-terminal modification should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified CJC-1295 construct.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water and counter-ion results.\n \u003cbr\u003e\n\n ✓ Counter-ion documentation – Acetate, trifluoroacetate or another counter-ion should be identified and quantified where applicable.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-controlled packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"cjc-1295-product-overview\"\u003e\n \u003cstrong\u003eCJC-1295 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eCJC-1295 research-grade synthetic peptide\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment and mass-spectrometry workflows. The material comprises a defined modified 30-residue peptide structure containing four specified amino-acid substitutions and a C-terminal maleimidopropionyl-lysine modification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, chromatographic purity, net peptide content, molecular form, sequence, modified-residue integrity, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine laboratory investigations, the Regular CJC-1295 specification remains highly suitable. The premium black-and-gold ULTIMATE CJC-1295 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP015.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP015.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50021364728146,"sku":"PEP015","price":15.85,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021364760914,"sku":"PEP015","price":30.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021364793682,"sku":"PEP015","price":55.85,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021364826450,"sku":"PEP015","price":100.5,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021364859218,"sku":"PEP015","price":230.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51242405200210,"sku":"PEP015","price":125.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51242409460050,"sku":"PEP015","price":250.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51242413588818,"sku":"PEP015","price":229.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51242416406866,"sku":"PEP015","price":458.5,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648342774098,"sku":"PEP015U","price":42.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648342806866,"sku":"PEP015U","price":77.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648342839634,"sku":"PEP015U","price":140.25,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648342872402,"sku":"PEP015U","price":322.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648342905170,"sku":"PEP015U","price":175.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648342937938,"sku":"PEP015U","price":350.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648343003474,"sku":"PEP015U","price":321.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766532788562,"sku":"PEP015U","price":642.85,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-cjc-1295-research-peptide-uk-pure-fine-powder.png?v=1767887054"},{"product_id":"cjc-1295-peptide-uk","title":"CJC-1295 MOD GRF 1-29 \/ WITHOUT DAC - Research Grade Peptide","description":"\u003ch3 id=\"cjc-1295-mod-grf-1-29-without-dac-research-grade-peptide\"\u003e\n \u003cstrong\u003e\n CJC-1295 MOD GRF 1-29 \/ WITHOUT DAC\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research Grade Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic 29-residue peptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Modified GRF 1–29 structure without the C-terminal DAC modification\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity of at least 99% where confirmed by the applicable batch Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared CJC-1295 MOD GRF 1-29 \/ WITHOUT DAC peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-cjc-1295-mod-grf-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-cjc-1295-mod-grf-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n CJC-1295 MOD GRF 1-29 \/ WITHOUT DAC\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Peptide Purification and LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE CJC-1295 MOD GRF 1-29 \/ WITHOUT DAC range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM RESEARCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular CJC-1295 MOD GRF 1-29 \/ WITHOUT DAC product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for research projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE CJC-1295 MOD GRF 1-29 \/ WITHOUT DAC remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, sequence, purity, peptide content, molecular form, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"cjc-1295-mod-grf-1-29-without-dac-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n CJC-1295 MOD GRF 1-29 \/ WITHOUT DAC\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Technical Description:\u003c\/strong\u003e\n Modified GRF (1–29)\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Modified GRF 1–29; MOD GRF 1–29; CJC-1295 Without DAC; CJC-1295 No DAC; tetrasubstituted GRF 1–29\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic linear 29-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 29 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n Y-[D-Ala]-DAIFTQSYRKVLAQLSARKLLQDILSR-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Modifications:\u003c\/strong\u003e\n D-alanine at position 2, glutamine at position 8, alanine at position 15 and leucine at position 27\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal argininamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDAC Status:\u003c\/strong\u003e\n Without the additional C-terminal albumin-binding DAC modification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReported CAS Number:\u003c\/strong\u003e\n 863288-34-0\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 56841945\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e152\u003c\/sub\u003eH\u003csub\u003e252\u003c\/sub\u003eN\u003csub\u003e44\u003c\/sub\u003eO\u003csub\u003e42\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 3367.95 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n At least 99% chromatographic purity where confirmed by the applicable batch Certificate of Analysis and stated analytical method\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion or Salt Form:\u003c\/strong\u003e\n Refer to the applicable Certificate of Analysis, as acetate, trifluoroacetate or another counter-ion may affect the recorded mass and net peptide content of the supplied material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eProduct Distinction:\u003c\/strong\u003e\n This product does not contain the C-terminal modified lysine associated with the separate CJC-1295 product\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Confirmation:\u003c\/strong\u003e\n Product identity should be confirmed using sequence records and mass-spectrometry data consistent with the specified 29-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Chromatographic purity, net peptide content, water content, residual solvent content and counter-ion content are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – Peptide sequence, residue substitutions and molecular identity should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified peptide construct.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water and counter-ion results.\n \u003cbr\u003e\n\n ✓ Counter-ion documentation – Acetate, trifluoroacetate or another counter-ion should be identified and quantified where applicable.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-controlled packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"cjc-1295-mod-grf-1-29-without-dac-product-overview\"\u003e\n \u003cstrong\u003eCJC-1295 MOD GRF 1-29 \/ WITHOUT DAC Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eCJC-1295 MOD GRF 1-29 \/ WITHOUT DAC research-grade synthetic peptide\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment and mass-spectrometry workflows. The material comprises a defined linear sequence of 29 amino-acid residues incorporating four specified sequence modifications and a C-terminal amide.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, chromatographic purity, net peptide content, molecular form, amino-acid sequence, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, investigative and general laboratory work, the Regular CJC-1295 MOD GRF 1-29 \/ WITHOUT DAC specification remains highly suitable. The premium black-and-gold ULTIMATE option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP016.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP016.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50021420761426,"sku":"PEP016","price":16.25,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021420794194,"sku":"PEP016","price":37.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021420826962,"sku":"PEP016","price":69.25,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021420859730,"sku":"PEP016","price":128.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021420892498,"sku":"PEP016","price":294.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51242463297874,"sku":"PEP016","price":153.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51242466443602,"sku":"PEP016","price":306.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51242469327186,"sku":"PEP016","price":286.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51242472145234,"sku":"PEP016","price":572.5,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648342511954,"sku":"PEP016U","price":52.5,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648342544722,"sku":"PEP016U","price":96.5,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648342577490,"sku":"PEP016U","price":179.25,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648342610258,"sku":"PEP016U","price":412.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648342643026,"sku":"PEP016U","price":215.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648342675794,"sku":"PEP016U","price":429.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648342741330,"sku":"PEP016U","price":400.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766532657490,"sku":"PEP016U","price":800.85,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-cjc-1295-peptide-uk-ultra-pure-research-grade.png?v=1767865430"},{"product_id":"cjc-1295-with-dac-for-research","title":"CJC-1295 WITH DAC - Research Grade Peptide","description":"\u003ch3 id=\"cjc-1295-with-dac-research-grade-peptide\"\u003e\n \u003cstrong\u003e\n CJC-1295 WITH DAC\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research Grade Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic CJC-1295 peptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined 30-residue modified peptide containing the C-terminal DAC-associated maleimide group\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity of at least 99% where confirmed by the applicable batch Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared CJC-1295 WITH DAC peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-cjc-1295-with-dac-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-cjc-1295-with-dac-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n CJC-1295 WITH DAC\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Peptide Purification and LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE CJC-1295 WITH DAC range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM QUALITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade CJC-1295 WITH DAC product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for research projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE CJC-1295 WITH DAC remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, sequence, purity, peptide content, modified-residue integrity, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"cjc-1295-with-dac-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n CJC-1295 WITH DAC\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n CJC-1295; CJC1295; maleimido-modified GRF 1–29 analogue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic modified 30-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Structural Description:\u003c\/strong\u003e\n Tetrasubstituted human growth hormone-releasing factor 1–29 analogue containing an additional C-terminal lysine bearing an N\u003csup\u003eε\u003c\/sup\u003e-3-maleimidopropionamide group\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 30 amino-acid residues, including the additional modified C-terminal lysine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n H-Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-Lys-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Modifications:\u003c\/strong\u003e\n D-alanine at position 2, glutamine at position 8, alanine at position 15 and leucine at position 27\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDAC-Associated Modification:\u003c\/strong\u003e\n The epsilon amino group of the additional C-terminal lysine carries a 3-maleimidopropionamide group\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Modified C-terminal lysinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePrimary CAS Number:\u003c\/strong\u003e\n 446262-90-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eHistorical or Deprecated CAS Reference:\u003c\/strong\u003e\n 863288-34-0\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 91971820\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUNII:\u003c\/strong\u003e\n 62RC32V9N7\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e165\u003c\/sub\u003eH\u003csub\u003e269\u003c\/sub\u003eN\u003csub\u003e47\u003c\/sub\u003eO\u003csub\u003e46\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 3647.2 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n At least 99% chromatographic purity where confirmed by the applicable batch Certificate of Analysis and stated analytical method\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSupplied Molecular Form:\u003c\/strong\u003e\n Maleimide-functionalised CJC-1295 peptide prior to albumin conjugation; the supplied vial does not contain an albumin-peptide complex unless expressly stated in the applicable batch documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eProduct Distinction:\u003c\/strong\u003e\n CJC-1295 WITH DAC contains the additional modified C-terminal lysine. CJC-1295 MOD GRF 1-29 \/ WITHOUT DAC does not contain this structural modification and has a different molecular formula and molecular weight\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion or Salt Form:\u003c\/strong\u003e\n Refer to the applicable Certificate of Analysis, as acetate, trifluoroacetate or another counter-ion may affect the measured mass and net peptide content of the supplied material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Confirmation:\u003c\/strong\u003e\n Product identity should be supported by sequence records and mass-spectrometry results consistent with the specified modified peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Chromatographic purity, net peptide content, molecular identity, water content, residual solvent content and counter-ion content are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – Peptide sequence, amino-acid substitutions and the C-terminal DAC-associated modification should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified modified CJC-1295 construct.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water and counter-ion results.\n \u003cbr\u003e\n\n ✓ Counter-ion documentation – Acetate, trifluoroacetate or another counter-ion should be identified and quantified where applicable.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-controlled packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"cjc-1295-with-dac-product-overview\"\u003e\n \u003cstrong\u003eCJC-1295 WITH DAC Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eCJC-1295 WITH DAC research-grade synthetic peptide\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment and mass-spectrometry workflows. The material comprises a defined modified 30-residue peptide structure containing four specified amino-acid substitutions and an additional C-terminal lysine carrying a maleimidopropionamide group.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, chromatographic purity, net peptide content, molecular form, amino-acid sequence, modified-residue integrity, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, investigative and general laboratory work, the Regular CJC-1295 WITH DAC specification remains highly suitable. The premium black-and-gold ULTIMATE CJC-1295 WITH DAC option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP017.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP017.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50021437079890,"sku":"PEP017","price":22.95,"currency_code":"GBP","in_stock":false},{"title":"2mg - special order - 11mm Chromatography Vial (non standard)","offer_id":51137395130706,"sku":"PEP017","price":22.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021437112658,"sku":"PEP017","price":40.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021437145426,"sku":"PEP017","price":75.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021437178194,"sku":"PEP017","price":140.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021437210962,"sku":"PEP017","price":330.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51242481549650,"sku":"PEP017","price":167.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51242484891986,"sku":"PEP017","price":333.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51242488529234,"sku":"PEP017","price":313.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51242491838802,"sku":"PEP017","price":625.5,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648342249810,"sku":"PEP017U","price":56.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648342282578,"sku":"PEP017U","price":105.25,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648342315346,"sku":"PEP017U","price":196.95,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648342348114,"sku":"PEP017U","price":462.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648342380882,"sku":"PEP017U","price":234.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648342413650,"sku":"PEP017U","price":467.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648342479186,"sku":"PEP017U","price":438.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766532624722,"sku":"PEP017U","price":875.95,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-cjc-1295-with-dac-pure-fine-peptide-powder.png?v=1767887054"},{"product_id":"buy-dermorphin-uk","title":"DERMORPHIN - Research Grade Peptide","description":"\u003ch3 data-start=\"141\" data-end=\"224\"\u003eDERMORPHIN - Research Grade Peptide\u003cbr\u003e\n\u003c\/h3\u003e\n\u003cp\u003e\u003cstrong data-start=\"145\" data-end=\"224\"\u003e\u003cspan style=\"color: rgb(255, 42, 0);\"\u003e\u003cstrong\u003e\u003cspan style=\"font-size: 10pt; font-family: Arial, sans-serif;\"\u003eFor research purposes only\u003c\/span\u003e\u003cspan style=\"font-size: 10pt; font-family: Arial, sans-serif;\"\u003e. \u003c\/span\u003e\u003c\/strong\u003e\u003cspan style=\"font-size: 10pt; font-family: Arial, sans-serif;\"\u003eThis product is supplied exclusively for scientific laboratory research and analytical purposes. It is not intended for human or animal use, and must not be misused in any way that contravenes MHRA regulations or applicable laws.\u003c\/span\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli class=\"MsoNormal\"\u003e\u003cb\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003eResearch Grade Peptide - batch documentation available where supplied\u003c\/span\u003e\u003c\/b\u003e\u003c\/li\u003e\n\u003cli class=\"MsoNormal\"\u003e\u003cb\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003eSupplied in sterile, flip-top headspace vials designed for laboratory use\u003c\/span\u003e\u003c\/b\u003e\u003c\/li\u003e\n\u003cli class=\"MsoNormal\"\u003e\u003cb\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003eHandled as a research-use laboratory supply\u003c\/span\u003e\u003c\/b\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp class=\"MsoNormal\"\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003eAll of our peptides are supplied strictly for research and laboratory use only. Each vial contains sterile, lyophilised powder that has been finely milled and sieved to ensure consistency. The stated weight refers to the content of a single vial. Reconstitution requires Bacteriostatic Water containing 0.9% Benzyl Alcohol (or a suitable equivalent). Please note that we do not offer any advice or recommendations regarding dosage, administration, or use in humans or animals.\u003c\/span\u003e\u003c\/p\u003e\n\u003ch3 data-start=\"447\" data-end=\"478\"\u003e\u003cstrong data-start=\"451\" data-end=\"476\"\u003eChemical Information:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cul data-start=\"479\" data-end=\"698\"\u003e\n\u003cli data-start=\"479\" data-end=\"549\"\u003e\n\u003cstrong data-start=\"481\" data-end=\"494\"\u003eSynonyms:\u003c\/strong\u003e (4-Hydroxyphenyl)Propanoyl]Pyrrolidine-2-Carboxamide\u003c\/li\u003e\n\u003cli data-start=\"550\" data-end=\"584\"\u003e\n\u003cstrong data-start=\"552\" data-end=\"567\"\u003eCAS Number:\u003c\/strong\u003e \u003cstrong data-start=\"568\" data-end=\"582\"\u003e77614-16-5\u003c\/strong\u003e\n\u003c\/li\u003e\n\u003cli data-start=\"585\" data-end=\"627\"\u003e\n\u003cstrong data-start=\"587\" data-end=\"609\"\u003eMolecular Formula:\u003c\/strong\u003e \u003cstrong data-start=\"610\" data-end=\"625\"\u003eC₄₀H₅₀N₈O₁₀\u003c\/strong\u003e\n\u003c\/li\u003e\n\u003cli data-start=\"628\" data-end=\"657\"\u003e\n\u003cstrong data-start=\"630\" data-end=\"651\"\u003eMolecular Weight:\u003c\/strong\u003e n\/a\u003c\/li\u003e\n\u003cli data-start=\"658\" data-end=\"698\"\u003e\n\u003cstrong data-start=\"660\" data-end=\"671\"\u003ePurity:\u003c\/strong\u003e \u003cstrong data-start=\"672\" data-end=\"696\"\u003e≥99% (Peptide-Grade)\u003c\/strong\u003e\n\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp class=\"MsoNormal\"\u003e\u003cspan style=\"font-family: 'Segoe UI Emoji',sans-serif; mso-bidi-font-family: 'Segoe UI Emoji'; color: black; mso-themecolor: text1;\"\u003e✅\u003c\/span\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e Batch documentation - COA documentation is provided where supplied for review.\u003cbr\u003e\u003c\/span\u003e\u003cspan style=\"font-family: 'Segoe UI Emoji',sans-serif; mso-bidi-font-family: 'Segoe UI Emoji'; color: black; mso-themecolor: text1;\"\u003e✅\u003c\/span\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e Certificate of Analysis (COA) – Instantly accessible via QR code for transparency\u003cbr\u003e\u003c\/span\u003e\u003cspan style=\"font-family: 'Segoe UI Emoji',sans-serif; mso-bidi-font-family: 'Segoe UI Emoji'; color: black; mso-themecolor: text1;\"\u003e✅\u003c\/span\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e Material Material Safety Data Sheet (MSDS) (MSDS) – Supplied to support safe handling and regulatory compliance\u003cbr\u003e\u003c\/span\u003e\u003cspan style=\"font-family: 'Segoe UI Emoji',sans-serif; mso-bidi-font-family: 'Segoe UI Emoji'; color: black; mso-themecolor: text1;\"\u003e✅\u003c\/span\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e Supplier documentation reviewed where records are supplied\u003cbr\u003e\u003c\/span\u003e\u003cspan style=\"font-family: 'Segoe UI Emoji',sans-serif; mso-bidi-font-family: 'Segoe UI Emoji'; color: black; mso-themecolor: text1;\"\u003e✅\u003c\/span\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e Fast, Reliable, Trackable Express Delivery – Securely packaged and dispatched Frozen in insulated packaging\u003cbr style=\"mso-special-character: line-break;\"\u003e\u003c!-- [if !supportLineBreakNewLine]--\u003e\u003cbr style=\"mso-special-character: line-break;\"\u003e\u003c!--[endif]--\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv class=\"MsoNormal\" align=\"center\" style=\"text-align: center;\"\u003e\u003chr size=\"2\" width=\"100%\" align=\"center\"\u003e\u003c\/div\u003e\n\u003cp class=\"MsoNormal\"\u003e\u003cb\u003e\u003cspan style=\"color: #c00000;\"\u003eFor Research Use Only\u003c\/span\u003e\u003c\/b\u003e\u003cspan style=\"color: #c00000;\"\u003e\u003cbr\u003eThis product is supplied strictly for scientific research and laboratory experimentation. It is not intended for human consumption, clinical use, or any form of therapeutic application.\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv class=\"MsoNormal\" align=\"center\" style=\"text-align: center;\"\u003e\u003chr size=\"2\" width=\"100%\" align=\"center\"\u003e\u003c\/div\u003e\n\u003cp class=\"MsoNormal\"\u003e\u003cb\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003eProduct Overview\u003c\/span\u003e\u003c\/b\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e\u003cbr\u003eOur DERMORPHIN\u003cb\u003e \u003c\/b\u003erepresents the forefront of precision chemical synthesis. Meticulously developed and rigorously tested, this research-grade compound is designed to support reliable, reproducible results in advanced research settings. Trusted by professionals across academic and commercial laboratories, it offers consistent handling for investigative and exploratory scientific work.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e  \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP018.pdf\"\u003eView Certificate of Analysis\u003c\/a\u003e\u003c\/p\u003e\n\u003cp\u003e \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP018.pdf\"\u003eView Material Material Safety Data Sheet (MSDS) (MSDS)\u003c\/a\u003e\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50021460607314,"sku":"PEP018","price":28.25,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021460640082,"sku":"PEP018","price":65.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021460672850,"sku":"PEP018","price":121.25,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021460705618,"sku":"PEP018","price":225.5,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021460738386,"sku":"PEP018","price":519.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243141398866,"sku":"PEP018","price":270.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243145462098,"sku":"PEP018","price":540.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243148902738,"sku":"PEP018","price":504.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243152015698,"sku":"PEP018","price":1008.5,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648341987666,"sku":"PEP018U","price":91.95,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648342020434,"sku":"PEP018U","price":170.25,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648342053202,"sku":"PEP018U","price":315.85,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648342085970,"sku":"PEP018U","price":726.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648342118738,"sku":"PEP018U","price":378.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648342151506,"sku":"PEP018U","price":756.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648342217042,"sku":"PEP018U","price":706.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766532591954,"sku":"PEP018U","price":1412.95,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-dermorphin-uk-ultra-pure-peptide-powder.png?v=1767865428"},{"product_id":"dihexa-research-peptide","title":"DIHEXA - Research Grade Peptide","description":"\u003ch3 id=\"dihexa-research-grade-peptidomimetic\"\u003e\n \u003cstrong\u003e\n DIHEXA\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Peptidomimetic\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade DIHEXA peptidomimetic with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined N-terminally hexanoylated Tyr-Ile-Ahx-NH\u003csub\u003e2\u003c\/sub\u003e molecular structure\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Analytical purity of at least 99% where confirmed by the applicable batch Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as measured laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n DIHEXA is an N-terminally modified research peptidomimetic comprising a tyrosine-isoleucine core and a 6-aminohexanamide component. Each vial contains measured laboratory material prepared to support consistent scientific handling, storage and analytical investigation. The stated nominal amount refers to the declared DIHEXA content of a single vial, subject to the applicable batch documentation. Where dissolution is required, the solvent, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-dihexa-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-dihexa-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n DIHEXA\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE DIHEXA range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of purification and quality control. Following the standard synthesis and purification process, the finished DIHEXA research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM QUALITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade DIHEXA product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of material quality, batch documentation and value. The ULTIMATE option is intended for research projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE DIHEXA remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, chromatographic purity, material content, residual solvent content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"dihexa-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n DIHEXA\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Dihexa; PNB-0408; N-hexanoyl-Tyr-Ile-(6-aminohexanoic amide); Hexanoyl-Tyr-Ile-Ahx-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n N-terminally acylated peptidomimetic and modified oligopeptide analogue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStructural Shorthand:\u003c\/strong\u003e\n Hexanoyl-Tyr-Ile-Ahx-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStructural Components:\u003c\/strong\u003e\n N-terminal hexanoyl group, L-tyrosine, L-isoleucine and a 6-aminohexanamide component\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSystematic Name:\u003c\/strong\u003e\n 6-[(2S,3S)-2-[(2S)-2-hexanamido-3-(4-hydroxyphenyl)propanamido]-3-methylpentanamido]hexanamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Chemical Name:\u003c\/strong\u003e\n N-(1-oxohexyl)-L-tyrosyl-N-(6-amino-6-oxohexyl)-L-isoleucinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 1401708-83-5\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 129010512\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUNII:\u003c\/strong\u003e\n 9WYX65A5C2\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e27\u003c\/sub\u003eH\u003csub\u003e44\u003c\/sub\u003eN\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 504.67 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eInChIKey:\u003c\/strong\u003e\n XEUVNVNAVKZSPT-JTJYXVOQSA-N\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n At least 99% chromatographic purity where confirmed by the applicable batch Certificate of Analysis and stated analytical method\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Laboratory powder or lyophilised material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n Molecular identity, stereochemistry and any counter-ion or solvate content should be confirmed using the applicable batch documentation and mass-spectrometry data\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Chromatographic purity, material content, water content, residual solvent content and any counter-ion or solvate contribution are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Identity documentation – Molecular identity and stereochemistry should be confirmed using the applicable batch analytical records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified DIHEXA structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Material-content documentation – Net material content should be distinguished from chromatographic purity and interpreted alongside water and residual solvent results.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-controlled packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"dihexa-product-overview\"\u003e\n \u003cstrong\u003eDIHEXA Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eDIHEXA research-grade peptidomimetic\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, compound characterisation, high-performance liquid chromatography assessment and mass-spectrometry workflows. The defined molecular structure incorporates an N-terminal hexanoyl group, a tyrosine-isoleucine core and a 6-aminohexanamide component.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, chromatographic purity, net material content, molecular form, stereochemistry, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net material content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, investigative and general laboratory work, the Regular DIHEXA specification remains highly suitable. The premium black-and-gold ULTIMATE DIHEXA option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP019.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP019.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"5mg","offer_id":50021483217234,"sku":"PEP019","price":120.5,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021483250002,"sku":"PEP019","price":203.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021483282770,"sku":"PEP019","price":351.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021483315538,"sku":"PEP019","price":512.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243163681106,"sku":"PEP019","price":566.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243171184978,"sku":"PEP019","price":1093.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243175543122,"sku":"PEP019","price":985.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243180491090,"sku":"PEP019","price":1890.85,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648341692754,"sku":"PEP019U","price":168.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648341725522,"sku":"PEP019U","price":284.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648341758290,"sku":"PEP019U","price":492.5,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648341791058,"sku":"PEP019U","price":717.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648341823826,"sku":"PEP019U","price":793.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648341856594,"sku":"PEP019U","price":1531.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648341922130,"sku":"PEP019U","price":1379.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766532362578,"sku":"PEP019U","price":2646.95,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-dihexa-research-peptide-ultra-pure-powder.png?v=1767887055"},{"product_id":"buy-dsip-peptide-uk","title":"DSIP - Research Grade Peptide","description":"\u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\n\u003ch3 id=\"dsip-research-grade-synthetic-nonapeptide\"\u003e\n \u003cstrong\u003e\n DSIP\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Synthetic Nonapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic nonapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined linear sequence comprising nine amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity of at least 99% where confirmed by the applicable batch Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared DSIP content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-dsip-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-dsip-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n DSIP\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Peptide Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE DSIP range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished DSIP research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM QUALITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade DSIP product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE DSIP remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, sequence, chromatographic purity, peptide content, molecular form, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"dsip-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n DSIP\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Emideltide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Delta sleep-inducing peptide; delta-sleep-inducing peptide; DSIP nonapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic linear nonapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Nine amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n H-Trp-Ala-Gly-Gly-Asp-Ala-Ser-Gly-Glu-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n WAGGDASGE\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 62568-57-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 68816\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n YN28Z5YZ73\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e35\u003c\/sub\u003eH\u003csub\u003e48\u003c\/sub\u003eN\u003csub\u003e10\u003c\/sub\u003eO\u003csub\u003e15\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 848.82 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMonoisotopic Mass:\u003c\/strong\u003e\n Approximately 848.3301 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n At least 99% chromatographic purity where confirmed by the applicable batch Certificate of Analysis and stated analytical method\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is uncountered DSIP, DSIP acetate, DSIP trifluoroacetate or another counter-ion form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion or Salt Form:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may alter the formula weight and net peptide content of the supplied material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Confirmation:\u003c\/strong\u003e\n Product identity should be supported by sequence documentation and mass-spectrometry results consistent with the specified DSIP nonapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Chromatographic purity, net peptide content, water content, residual solvent content and counter-ion content are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – Peptide sequence and molecular identity should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified DSIP sequence.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water and counter-ion results.\n \u003cbr\u003e\n\n ✓ Counter-ion documentation – Acetate, trifluoroacetate or another counter-ion should be identified and quantified where applicable.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-controlled packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"dsip-product-overview\"\u003e\n \u003cstrong\u003eDSIP Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eDSIP research-grade synthetic nonapeptide\u003c\/strong\u003e,\n also known as delta sleep-inducing peptide or emideltide, is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment and mass-spectrometry workflows. The material comprises a defined linear sequence of nine amino-acid residues with free amino and carboxylic acid termini.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, chromatographic purity, net peptide content, molecular form, amino-acid sequence, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, investigative and general laboratory work, the Regular DSIP specification remains highly suitable. The premium black-and-gold ULTIMATE DSIP option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP020.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP020.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"5mg","offer_id":50021494292818,"sku":"PEP020","price":23.25,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021494325586,"sku":"PEP020","price":42.25,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021494358354,"sku":"PEP020","price":78.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021494391122,"sku":"PEP020","price":178.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243227152722,"sku":"PEP020","price":93.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243229839698,"sku":"PEP020","price":186.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243232887122,"sku":"PEP020","price":173.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243237769554,"sku":"PEP020","price":346.5,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656977994066,"sku":"PEP020U","price":33.5,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656978026834,"sku":"PEP020U","price":61.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656978059602,"sku":"PEP020U","price":112.95,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656978092370,"sku":"PEP020U","price":259.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656978125138,"sku":"PEP020U","price":135.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656978157906,"sku":"PEP020U","price":269.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656978223442,"sku":"PEP020U","price":251.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766532297042,"sku":"PEP020U","price":502.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-dsip-peptide-uk-pure-fine-peptide-powder.png?v=1767865429"},{"product_id":"epithalon-peptide-uk","title":"EPITHALON - Research Grade Peptide","description":"\u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\n\u003ch3 id=\"epithalon-research-grade-synthetic-tetrapeptide\"\u003e\n \u003cstrong\u003e\n EPITHALON\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Synthetic Tetrapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic tetrapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined linear peptide sequence comprising four amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity of at least 99% where confirmed by the applicable batch Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared Epithalon peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-epithalon-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-epithalon-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n EPITHALON\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Peptide Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE Epithalon range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished Epithalon research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM RESEARCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade Epithalon product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE Epithalon remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, sequence, chromatographic purity, peptide content, molecular form, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"epithalon-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n EPITHALON\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Database Name:\u003c\/strong\u003e\n Epitalon\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Epithalon; AEDG peptide; Ala-Glu-Asp-Gly\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Clarification:\u003c\/strong\u003e\n Epithalamin or Epithalamine is a different pineal-derived polypeptide complex and is not a synonym for the synthetic Epitalon tetrapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic linear tetrapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Four amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n H-Ala-Glu-Asp-Gly-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n AEDG\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence-Based Chemical Name:\u003c\/strong\u003e\n L-alanyl-L-glutamyl-L-aspartylglycine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Form CAS Number:\u003c\/strong\u003e\n 307297-39-8\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 219042\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n O65P17785G\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Form Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e14\u003c\/sub\u003eH\u003csub\u003e22\u003c\/sub\u003eN\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e9\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Form Average Molecular Weight:\u003c\/strong\u003e\n Approximately 390.35 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEpitalon Acetate CAS Number:\u003c\/strong\u003e\n 307297-40-1\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEpitalon Acetate Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e14\u003c\/sub\u003eH\u003csub\u003e22\u003c\/sub\u003eN\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e9\u003c\/sub\u003e\n ·\n C\u003csub\u003e2\u003c\/sub\u003eH\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e2\u003c\/sub\u003e,\n equivalent to C\u003csub\u003e16\u003c\/sub\u003eH\u003csub\u003e26\u003c\/sub\u003eN\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e11\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEpitalon Acetate Average Molecular Weight:\u003c\/strong\u003e\n Approximately 450.40 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n At least 99% chromatographic purity where confirmed by the applicable batch Certificate of Analysis and stated analytical method\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is Epitalon free form, Epitalon acetate or another counter-ion form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Confirmation:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect the formula weight, water content and net peptide content of the supplied laboratory material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Chromatographic purity, molecular identity, net peptide content, water content, residual solvent content and counter-ion content are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – Peptide sequence and molecular identity should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Analytical identity documentation – Molecular identity should be supported by appropriate analytical data for the applicable batch.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water and counter-ion results.\n \u003cbr\u003e\n\n ✓ Counter-ion documentation – Acetate, trifluoroacetate or another counter-ion should be identified and quantified where applicable.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-controlled packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"epithalon-product-overview\"\u003e\n \u003cstrong\u003eEpithalon Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eEpithalon research-grade synthetic tetrapeptide\u003c\/strong\u003e,\n also known as Epitalon or the AEDG peptide, is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment and mass-spectrometry workflows. The material comprises a defined linear sequence of four amino-acid residues with free amino and carboxylic acid termini.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, chromatographic purity, net peptide content, molecular form, amino-acid sequence, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, investigative and general laboratory work, the Regular Epithalon specification remains highly suitable. The premium black-and-gold ULTIMATE Epithalon option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP021.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP021.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50021811388754,"sku":"PEP021","price":5.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021811421522,"sku":"PEP021","price":12.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021811454290,"sku":"PEP021","price":22.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021811487058,"sku":"PEP021","price":41.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021811519826,"sku":"PEP021","price":93.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243251728722,"sku":"PEP021","price":49.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243257037138,"sku":"PEP021","price":97.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243258806610,"sku":"PEP021","price":90.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243262673234,"sku":"PEP021","price":180.25,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656977371474,"sku":"PEP021U","price":17.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656977404242,"sku":"PEP021U","price":32.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656977437010,"sku":"PEP021U","price":59.25,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656977469778,"sku":"PEP021U","price":135.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656977502546,"sku":"PEP021U","price":70.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656977535314,"sku":"PEP021U","price":140.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656977600850,"sku":"PEP021U","price":131.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766532100434,"sku":"PEP021U","price":261.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupexx-epithalon-peptide-uk-pure-fine-powder.png?v=1767887054"},{"product_id":"ghk-cu-peptide-research","title":"GHK-CU - Research Grade Peptide","description":"\u003ch3 id=\"ghk-cu-research-grade-copper-tripeptide-formulation\"\u003e\n \u003cstrong\u003e\n GHK-CU\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Copper Tripeptide Formulation\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade GHK-Cu copper tripeptide formulation with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined Gly-His-Lys tripeptide component formulated with a copper(II) source\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, peptide purity, copper content and formulation specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides, metal-peptide complexes and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared GHK-Cu formulation content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT GHK-CU FORMULATION NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 19px 21px;\n background: linear-gradient(135deg, #f4fbff 0%, #eaf7fc 100%);\n border: 1px solid #8bcce5;\n border-left: 5px solid #008ebf;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 91, 126, 0.08);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 8px;\n color: #00698d;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n text-transform: uppercase;\n \"\u003e\n Important Formulation Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #173b49;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n \u003cstrong\u003eThis product contains a copper(II) sulphate source.\u003c\/strong\u003e\n The exact copper salt form, copper concentration, peptide-to-copper ratio and formulation composition are batch-specific and should be confirmed using the applicable Certificate of Analysis and formulation record.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #173b49;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n No cosmetic or food dyes are intentionally added. The predominantly colourless peptide and mannitol matrix means that the dry lyophilised presentation may appear white to off-white rather than vividly blue. Colour alone must not be used as evidence of peptide identity, copper content, purity or complex formation.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT GHK-CU FORMULATION NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-ghk-cu-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-ghk-cu-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n GHK-CU\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Peptide Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification of the GHK peptide component and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE GHK-CU range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. The GHK peptide component undergoes an additional preparative high-performance liquid chromatography purification stage before the final copper formulation and lyophilisation process. This additional stage is designed to reduce residual synthesis-related and process-related peptide impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional GHK Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n The GHK peptide component receives a further preparative high-performance liquid chromatography purification stage before final formulation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- FORMULATION CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Formulation Control\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring enhanced peptide purification, copper formulation control and documented quality parameters.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade GHK-CU product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of material quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE GHK-CU remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Peptide identity, chromatographic purity, copper content, complexation status, formulation composition, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"ghk-cu-chemical-and-formulation-information\"\u003e\n \u003cstrong\u003eChemical and Formulation Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n GHK-CU\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Chemical Styling:\u003c\/strong\u003e\n GHK-Cu\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Copper tripeptide-1; GHK copper complex; Cu-GHK; prezatide copper\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Copper(II)-tripeptide laboratory formulation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Component:\u003c\/strong\u003e\n Glycyl-L-histidyl-L-lysine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n H-Gly-His-Lys-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n GHK\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Three amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUncomplexed GHK CAS Number:\u003c\/strong\u003e\n 49557-75-7\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUncomplexed GHK Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e14\u003c\/sub\u003eH\u003csub\u003e24\u003c\/sub\u003eN\u003csub\u003e6\u003c\/sub\u003eO\u003csub\u003e4\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUncomplexed GHK Average Molecular Weight:\u003c\/strong\u003e\n Approximately 340.38 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference GHK-Cu Complex CAS Number:\u003c\/strong\u003e\n 89030-95-5\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference GHK-Cu Complex Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e14\u003c\/sub\u003eH\u003csub\u003e22\u003c\/sub\u003eCuN\u003csub\u003e6\u003c\/sub\u003eO\u003csub\u003e4\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference GHK-Cu Complex Average Molecular Weight:\u003c\/strong\u003e\n Approximately 401.91 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eGHK-Cu Unique Ingredient Identifier:\u003c\/strong\u003e\n 6BJQ43T1I9\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCopper Source in This Formulation:\u003c\/strong\u003e\n Copper(II) sulphate, with the exact hydrate form, amount and specification to be confirmed using the applicable batch formulation record\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eLaboratory Matrix:\u003c\/strong\u003e\n Mannitol-containing lyophilised matrix, with the exact composition stated in the applicable formulation and batch documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eArtificial Colouring:\u003c\/strong\u003e\n No cosmetic or food dyes are intentionally added\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance Clarification:\u003c\/strong\u003e\n The visible colour of a formulated lyophilised material is influenced by peptide concentration, copper concentration, complexation status, mannitol content, moisture and batch presentation. Colour alone does not establish chemical identity or purity.\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplexation Status:\u003c\/strong\u003e\n The applicable Certificate of Analysis should state whether the supplied material contains a preformed GHK-Cu complex or a formulation of GHK with a copper(II) sulphate source\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCopper Stoichiometry:\u003c\/strong\u003e\n The molar peptide-to-copper ratio and total copper content should be confirmed using appropriate batch-specific analytical data\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n High-performance liquid chromatography purity of the GHK peptide component does not, by itself, establish copper content, copper complexation, mannitol content or total formulated material content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Peptide identity, chromatographic purity, copper content, copper oxidation state, complexation status, water content, residual solvent content, sulphate content and mannitol content are separate quality attributes and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Peptide identity documentation – The GHK sequence and molecular identity should be confirmed using appropriate batch analytical records.\n \u003cbr\u003e\n\n ✓ Copper-content documentation – Copper identity, concentration and peptide-to-copper ratio should be confirmed where applicable.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method, peptide component and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Formulation documentation – Copper(II) sulphate, mannitol and any other formulation components should be declared in the applicable product records.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification, formulation and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"ghk-cu-product-overview\"\u003e\n \u003cstrong\u003eGHK-CU Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eGHK-CU research-grade copper tripeptide formulation\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows, copper-content analysis and formulation research. The peptide component comprises the defined tripeptide sequence glycyl-L-histidyl-L-lysine, commonly abbreviated as GHK.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The finished lyophilised material is formulated with a copper(II) sulphate source and a mannitol-containing laboratory matrix. No cosmetic or food dyes are intentionally added. The white to off-white appearance of the dry presentation reflects the formulated matrix and must not be interpreted independently as evidence of copper concentration, peptide purity or complex formation.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Product identity, chromatographic purity, net peptide content, copper content, peptide-to-copper ratio, complexation status, sulphate content, mannitol content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic peptide purity should not automatically be interpreted as equivalent to total GHK-Cu complex content or total formulated material content.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, investigative and general laboratory work, the Regular GHK-CU specification remains highly suitable. The premium black-and-gold ULTIMATE GHK-CU option uses a GHK peptide component subjected to an additional preparative high-performance liquid chromatography purification stage and applies a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP023.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP023.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50021885772114,"sku":"PEP023","price":4.85,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021885804882,"sku":"PEP023","price":7.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021885837650,"sku":"PEP023","price":13.25,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021885870418,"sku":"PEP023","price":23.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021885903186,"sku":"PEP023","price":52.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243382341970,"sku":"PEP023","price":27.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243383652690,"sku":"PEP023","price":54.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243384340818,"sku":"PEP023","price":51.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243384865106,"sku":"PEP023","price":101.95,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656976126290,"sku":"PEP023U","price":10.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656976159058,"sku":"PEP023U","price":18.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656976191826,"sku":"PEP023U","price":33.85,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656976224594,"sku":"PEP023U","price":76.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656976257362,"sku":"PEP023U","price":40.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656976290130,"sku":"PEP023U","price":79.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656976355666,"sku":"PEP023U","price":74.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766531772754,"sku":"PEP023U","price":147.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-ghk-cu-peptide-research-ultra-pure-powder.png?v=1767865921"},{"product_id":"buy-ghrp-2-uk-research-grade-peptide","title":"GHRP-2 - Research Grade Peptide","description":"\u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\n\u003ch3 id=\"ghrp-2-research-grade-synthetic-hexapeptide\"\u003e\n \u003cstrong\u003e\n GHRP-2\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Synthetic Hexapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic hexapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined modified peptide sequence comprising six amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared GHRP-2 peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-ghrp-2-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-ghrp-2-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n GHRP-2\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Peptide Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE GHRP-2 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished GHRP-2 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM QUALITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade GHRP-2 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE GHRP-2 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, sequence, chromatographic purity, peptide content, molecular form, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"ghrp-2-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n GHRP-2\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Pralmorelin\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Growth Hormone-Releasing Peptide 2; GHRP2; KP-102\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic modified hexapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Six amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n D-Ala-D-2-Nal-Ala-Trp-D-Phe-Lys-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eExpanded Sequence Description:\u003c\/strong\u003e\n D-alanyl-3-(2-naphthyl)-D-alanyl-L-alanyl-L-tryptophyl-D-phenylalanyl-L-lysinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNon-Standard Residue:\u003c\/strong\u003e\n D-2-Nal denotes 3-(2-naphthyl)-D-alanine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStereochemical Features:\u003c\/strong\u003e\n Contains D-alanine, D-2-naphthylalanine and D-phenylalanine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal lysinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Base CAS Number:\u003c\/strong\u003e\n 158861-67-7\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 6918245\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n E6S6E1F19M\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Base Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e45\u003c\/sub\u003eH\u003csub\u003e55\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e6\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Base Average Molecular Weight:\u003c\/strong\u003e\n Approximately 817.98 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePralmorelin Dihydrochloride CAS Number:\u003c\/strong\u003e\n 158827-34-0\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePralmorelin Dihydrochloride Formula:\u003c\/strong\u003e\n C\u003csub\u003e45\u003c\/sub\u003eH\u003csub\u003e55\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e6\u003c\/sub\u003e\n ·\n 2HCl\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePralmorelin Dihydrochloride Average Molecular Weight:\u003c\/strong\u003e\n Approximately 890.90 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePralmorelin Dihydrochloride Unique Ingredient Identifier:\u003c\/strong\u003e\n R4AVR27MM8\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is pralmorelin free base, pralmorelin dihydrochloride, an acetate form or another counter-ion form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Confirmation:\u003c\/strong\u003e\n Hydrochloride, acetate, trifluoroacetate or another counter-ion may affect the measured formula weight, water content and net peptide content of the supplied material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Confirmation:\u003c\/strong\u003e\n Product identity should be supported by sequence documentation and mass-spectrometry results consistent with the specified GHRP-2 molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Chromatographic purity, molecular identity, net peptide content, water content, residual solvent content and counter-ion content are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The modified hexapeptide sequence, stereochemistry and molecular identity should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified GHRP-2 structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water and counter-ion results.\n \u003cbr\u003e\n\n ✓ Counter-ion documentation – Hydrochloride, acetate, trifluoroacetate or another counter-ion should be identified and quantified where applicable.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"ghrp-2-product-overview\"\u003e\n \u003cstrong\u003eGHRP-2 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eGHRP-2 research-grade synthetic hexapeptide\u003c\/strong\u003e,\n also known as pralmorelin or KP-102, is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment and mass-spectrometry workflows. The material comprises a defined modified sequence of six amino-acid residues containing specified D-amino-acid and naphthylalanine components.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, chromatographic purity, net peptide content, molecular form, stereochemistry, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, investigative and general laboratory work, the Regular GHRP-2 specification remains highly suitable. The premium black-and-gold ULTIMATE GHRP-2 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP024.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP024.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50021925454162,"sku":"PEP024","price":5.85,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021925486930,"sku":"PEP024","price":11.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021925519698,"sku":"PEP024","price":21.25,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021925552466,"sku":"PEP024","price":38.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021925585234,"sku":"PEP024","price":88.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243389813074,"sku":"PEP024","price":46.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243390140754,"sku":"PEP024","price":92.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243390697810,"sku":"PEP024","price":86.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243390959954,"sku":"PEP024","price":171.25,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648341430610,"sku":"PEP024U","price":16.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648341463378,"sku":"PEP024U","price":29.95,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648341496146,"sku":"PEP024U","price":54.95,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648341528914,"sku":"PEP024U","price":123.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648341561682,"sku":"PEP024U","price":64.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648341594450,"sku":"PEP024U","price":128.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648341659986,"sku":"PEP024U","price":120.85,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766531707218,"sku":"PEP024U","price":239.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-ghrp-2-uk-pure-fine-peptide-powder.png?v=1767887082"},{"product_id":"ghrp-6-peptide-uk","title":"GHRP-6 - Research Grade Peptide","description":"\u003ch3 id=\"ghrp-6-research-grade-synthetic-hexapeptide\"\u003e\n \u003cstrong\u003e\n GHRP-6\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Synthetic Hexapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic hexapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined modified peptide sequence comprising six amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared GHRP-6 peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-ghrp-6-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-ghrp-6-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n GHRP-6\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Peptide Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE GHRP-6 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished GHRP-6 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM QUALITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade GHRP-6 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE GHRP-6 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, sequence, chromatographic purity, peptide content, molecular form, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"ghrp-6-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n GHRP-6\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Hexapeptide-2\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Growth Hormone-Releasing Peptide 6; Growth Hormone-Releasing Hexapeptide; GHRP6; Melanostatine 2; SK\u0026amp;F-110679; SKF-110679; U-75799E\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic modified hexapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Six amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n H-His-D-Trp-Ala-Trp-D-Phe-Lys-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence-Based Chemical Name:\u003c\/strong\u003e\n L-histidyl-D-tryptophyl-L-alanyl-L-tryptophyl-D-phenylalanyl-L-lysinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStereochemical Features:\u003c\/strong\u003e\n Contains D-tryptophan and D-phenylalanine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free histidine amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal lysinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 87616-84-0\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 9919153\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n 4H7N4I6X6A\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e46\u003c\/sub\u003eH\u003csub\u003e56\u003c\/sub\u003eN\u003csub\u003e12\u003c\/sub\u003eO\u003csub\u003e6\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 873.0 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result and analytical method are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is uncountered GHRP-6, an acetate form, a trifluoroacetate form or another counter-ion form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Confirmation:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect the recorded formula weight, water content and net peptide content of the supplied laboratory material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Confirmation:\u003c\/strong\u003e\n Product identity should be supported by sequence documentation and mass-spectrometry results consistent with the specified GHRP-6 molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Chromatographic purity, molecular identity, net peptide content, water content, residual solvent content and counter-ion content are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The modified hexapeptide sequence, stereochemistry and molecular identity should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified GHRP-6 structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water and counter-ion results.\n \u003cbr\u003e\n\n ✓ Counter-ion documentation – Acetate, trifluoroacetate or another counter-ion should be identified and quantified where applicable.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"ghrp-6-product-overview\"\u003e\n \u003cstrong\u003eGHRP-6 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eGHRP-6 research-grade synthetic hexapeptide\u003c\/strong\u003e,\n also known as Hexapeptide-2, is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment and mass-spectrometry workflows. The material comprises a defined modified sequence of six amino-acid residues containing D-tryptophan and D-phenylalanine components.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, chromatographic purity, net peptide content, molecular form, stereochemistry, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, investigative and general laboratory work, the Regular GHRP-6 specification remains highly suitable. The premium black-and-gold ULTIMATE GHRP-6 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP025.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP025.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50021957730642,"sku":"PEP025","price":6.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021957763410,"sku":"PEP025","price":13.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021957796178,"sku":"PEP025","price":24.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021957828946,"sku":"PEP025","price":45.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021957861714,"sku":"PEP025","price":103.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243392663890,"sku":"PEP025","price":54.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243393155410,"sku":"PEP025","price":108.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243393352018,"sku":"PEP025","price":100.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243393843538,"sku":"PEP025","price":200.25,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648341037394,"sku":"PEP025U","price":18.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648341070162,"sku":"PEP025U","price":34.5,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648341102930,"sku":"PEP025U","price":63.5,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648341135698,"sku":"PEP025U","price":144.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648341168466,"sku":"PEP025U","price":75.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648341201234,"sku":"PEP025U","price":150.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648341266770,"sku":"PEP025U","price":140.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766531674450,"sku":"PEP025U","price":279.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-ghrp-6-peptide-uk-pure-fine-powder.png?v=1767887080"},{"product_id":"buy-hexarelin-peptide-uk","title":"HEXARELIN - Research Grade Peptide","description":"\u003ch3 data-start=\"154\" data-end=\"249\"\u003eHEXARELIN - Research Grade Peptide\u003cbr\u003e\n\u003c\/h3\u003e\n\u003cp\u003e\u003cstrong data-start=\"158\" data-end=\"249\"\u003e\u003cspan style=\"color: rgb(255, 42, 0);\"\u003e\u003cstrong\u003e\u003cspan style=\"font-size: 10pt; font-family: Arial, sans-serif;\"\u003eFor research purposes only\u003c\/span\u003e\u003cspan style=\"font-size: 10pt; font-family: Arial, sans-serif;\"\u003e. \u003c\/span\u003e\u003c\/strong\u003e\u003cspan style=\"font-size: 10pt; font-family: Arial, sans-serif;\"\u003eThis product is supplied exclusively for scientific laboratory research and analytical purposes. It is not intended for human or animal use, and must not be misused in any way that contravenes MHRA regulations or applicable laws.\u003c\/span\u003e\u003c\/span\u003e\u003c\/strong\u003e\u003c\/p\u003e\n\u003cul\u003e\n\u003cli class=\"MsoNormal\"\u003e\u003cb\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003eResearch Grade Peptide - batch documentation available where supplied\u003c\/span\u003e\u003c\/b\u003e\u003c\/li\u003e\n\u003cli class=\"MsoNormal\"\u003e\u003cb\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003eSupplied in sterile, flip-top headspace vials designed for laboratory use\u003c\/span\u003e\u003c\/b\u003e\u003c\/li\u003e\n\u003cli class=\"MsoNormal\"\u003e\u003cb\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003eHandled as a research-use laboratory supply\u003c\/span\u003e\u003c\/b\u003e\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp class=\"MsoNormal\"\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003eAll of our peptides are supplied strictly for research and laboratory use only. Each vial contains sterile, lyophilised powder that has been finely milled and sieved to ensure consistency. The stated weight refers to the content of a single vial. Reconstitution requires Bacteriostatic Water containing 0.9% Benzyl Alcohol (or a suitable equivalent). Please note that we do not offer any advice or recommendations regarding dosage, administration, or use in humans or animals.\u003c\/span\u003e\u003c\/p\u003e\n\u003ch3 data-start=\"472\" data-end=\"503\"\u003e\u003cstrong data-start=\"476\" data-end=\"501\"\u003eChemical Information:\u003c\/strong\u003e\u003c\/h3\u003e\n\u003cul data-start=\"504\" data-end=\"693\"\u003e\n\u003cli data-start=\"504\" data-end=\"543\"\u003e\n\u003cstrong data-start=\"506\" data-end=\"519\"\u003eSynonyms:\u003c\/strong\u003e Hexarelin, Examorelin\u003c\/li\u003e\n\u003cli data-start=\"544\" data-end=\"579\"\u003e\n\u003cstrong data-start=\"546\" data-end=\"561\"\u003eCAS Number:\u003c\/strong\u003e \u003cstrong data-start=\"562\" data-end=\"577\"\u003e140703-51-1\u003c\/strong\u003e\n\u003c\/li\u003e\n\u003cli data-start=\"580\" data-end=\"622\"\u003e\n\u003cstrong data-start=\"582\" data-end=\"604\"\u003eMolecular Formula:\u003c\/strong\u003e \u003cstrong data-start=\"605\" data-end=\"620\"\u003eC₄₇H₅₈N₁₂O₆\u003c\/strong\u003e\n\u003c\/li\u003e\n\u003cli data-start=\"623\" data-end=\"652\"\u003e\n\u003cstrong data-start=\"625\" data-end=\"646\"\u003eMolecular Weight:\u003c\/strong\u003e n\/a\u003c\/li\u003e\n\u003c\/ul\u003e\n\u003cp class=\"MsoNormal\"\u003e\u003cb\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e \u003c\/span\u003e\u003c\/b\u003e\u003c\/p\u003e\n\u003cp class=\"MsoNormal\"\u003e\u003cspan style=\"font-family: 'Segoe UI Emoji',sans-serif; mso-bidi-font-family: 'Segoe UI Emoji'; color: black; mso-themecolor: text1;\"\u003e✅\u003c\/span\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e Batch documentation - COA documentation is provided where supplied for review.\u003cbr\u003e\u003c\/span\u003e\u003cspan style=\"font-family: 'Segoe UI Emoji',sans-serif; mso-bidi-font-family: 'Segoe UI Emoji'; color: black; mso-themecolor: text1;\"\u003e✅\u003c\/span\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e Certificate of Analysis (COA) – Instantly accessible via QR code for transparency\u003cbr\u003e\u003c\/span\u003e\u003cspan style=\"font-family: 'Segoe UI Emoji',sans-serif; mso-bidi-font-family: 'Segoe UI Emoji'; color: black; mso-themecolor: text1;\"\u003e✅\u003c\/span\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e Material Material Safety Data Sheet (MSDS) (MSDS) – Supplied to support safe handling and regulatory compliance\u003cbr\u003e\u003c\/span\u003e\u003cspan style=\"font-family: 'Segoe UI Emoji',sans-serif; mso-bidi-font-family: 'Segoe UI Emoji'; color: black; mso-themecolor: text1;\"\u003e✅\u003c\/span\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e Supplier documentation reviewed where records are supplied\u003cbr\u003e\u003c\/span\u003e\u003cspan style=\"font-family: 'Segoe UI Emoji',sans-serif; mso-bidi-font-family: 'Segoe UI Emoji'; color: black; mso-themecolor: text1;\"\u003e✅\u003c\/span\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e Fast, Reliable, Trackable Express Delivery – Securely packaged and dispatched Frozen in insulated packaging\u003cbr style=\"mso-special-character: line-break;\"\u003e\u003c!-- [if !supportLineBreakNewLine]--\u003e\u003cbr style=\"mso-special-character: line-break;\"\u003e\u003c!--[endif]--\u003e\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv class=\"MsoNormal\" align=\"center\" style=\"text-align: center;\"\u003e\u003chr size=\"2\" width=\"100%\" align=\"center\"\u003e\u003c\/div\u003e\n\u003cp class=\"MsoNormal\"\u003e\u003cb\u003e\u003cspan style=\"color: #c00000;\"\u003eFor Research Use Only\u003c\/span\u003e\u003c\/b\u003e\u003cspan style=\"color: #c00000;\"\u003e\u003cbr\u003eThis product is supplied strictly for scientific research and laboratory experimentation. It is not intended for human consumption, clinical use, or any form of therapeutic application.\u003c\/span\u003e\u003c\/p\u003e\n\u003cdiv class=\"MsoNormal\" align=\"center\" style=\"text-align: center;\"\u003e\u003chr size=\"2\" width=\"100%\" align=\"center\"\u003e\u003c\/div\u003e\n\u003cp class=\"MsoNormal\"\u003e\u003cb\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003eProduct Overview\u003c\/span\u003e\u003c\/b\u003e\u003cspan style=\"color: black; mso-themecolor: text1;\"\u003e\u003cbr\u003eOur HEXARELIN\u003cb\u003e \u003c\/b\u003erepresents the forefront of precision chemical synthesis. Meticulously developed and rigorously tested, this research-grade compound is designed to support reliable, reproducible results in advanced research settings. Trusted by professionals across academic and commercial laboratories, it offers consistent handling for investigative and exploratory scientific work.\u003c\/span\u003e\u003c\/p\u003e\n\u003cp\u003e  \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP026.pdf\"\u003eView Certificate of Analysis\u003c\/a\u003e\u003c\/p\u003e\n\u003cp\u003e \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP026.pdf\"\u003eView Material Material Safety Data Sheet (MSDS) (MSDS)\u003c\/a\u003e\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50021981389138,"sku":"PEP026","price":19.25,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50021981421906,"sku":"PEP026","price":42.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50021981454674,"sku":"PEP026","price":82.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50021981487442,"sku":"PEP026","price":151.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50021981520210,"sku":"PEP026","price":349.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243394761042,"sku":"PEP026","price":175.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243394990418,"sku":"PEP026","price":349.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243396858194,"sku":"PEP026","price":339.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243397218642,"sku":"PEP026","price":677.85,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648339431762,"sku":"PEP026U","price":59.95,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648339464530,"sku":"PEP026U","price":114.5,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648339497298,"sku":"PEP026U","price":212.5,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648339530066,"sku":"PEP026U","price":488.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648339562834,"sku":"PEP026U","price":244.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648339595602,"sku":"PEP026U","price":488.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648339661138,"sku":"PEP026U","price":474.85,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766531543378,"sku":"PEP026U","price":948.85,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-hexarelin-peptide-uk-ultra-pure-powder.png?v=1767887081"},{"product_id":"igf-1-lr3-peptide-uk","title":"IGF-1 LR3 - Research Grade Peptide","description":"\u003ch3 id=\"igf-1-lr3-research-grade-polypeptide\"\u003e\n \u003cstrong\u003e\n IGF-1 LR3\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Polypeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade, sequence-defined 83-residue polypeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Long R3 IGF-I structure containing a 13-residue N-terminal extension and an arginine substitution within the IGF-I domain\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, polypeptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research polypeptides, proteins and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support consistent laboratory handling and storage. The stated nominal amount refers to the declared IGF-1 LR3 content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-igf-1-lr3-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-igf-1-lr3-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n IGF-1 LR3\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE IGF-1 LR3 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of polypeptide purification and quality control. Following the standard production, folding and purification workflow, the finished IGF-1 LR3 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual process-related and product-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard production and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM BATCH DOCUMENTATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, biochemical, cell-culture and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade IGF-1 LR3 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of material quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE IGF-1 LR3 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, sequence, chromatographic purity, polypeptide content, molecular form, disulphide-bond integrity, aggregation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"igf-1-lr3-chemical-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n IGF-1 LR3\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Scientific Description:\u003c\/strong\u003e\n Long R3 insulin-like growth factor I\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Long R3 IGF-I; Long-R3-IGF-I; Long [Arg\u003csup\u003e3\u003c\/sup\u003e] IGF-I; LR3 IGF-I; IGF-I LR3\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Sequence-defined, modified 83-residue polypeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Structural Form:\u003c\/strong\u003e\n Single, non-glycosylated polypeptide chain containing three intramolecular disulphide bonds\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 83 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFull Amino-Acid Sequence:\u003c\/strong\u003e\n MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Extension:\u003c\/strong\u003e\n MFPAMPLSSLFVN\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Extension Length:\u003c\/strong\u003e\n 13 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIGF-I Domain Modification:\u003c\/strong\u003e\n Arginine replaces glutamic acid at position 3 of the mature IGF-I domain\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free methionine amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free alanine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n Three intramolecular disulphide bonds in the correctly folded reference structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 143045-27-6\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFolded Polypeptide Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e400\u003c\/sub\u003eH\u003csub\u003e619\u003c\/sub\u003eN\u003csub\u003e111\u003c\/sub\u003eO\u003csub\u003e115\u003c\/sub\u003eS\u003csub\u003e9\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 9111.45 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eApproximate Molecular Size:\u003c\/strong\u003e\n 9.1 kDa\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the folded, disulphide-bonded, untagged polypeptide without formulation excipients, counter-ions, water or other batch-dependent components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eProduction Method:\u003c\/strong\u003e\n The expression system, synthesis route, purification procedure and folding process should be confirmed using the applicable supplier and batch documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTag Status:\u003c\/strong\u003e\n The presence or absence of an affinity tag, linker sequence or additional terminal residues should be confirmed using sequence and mass-spectrometry documentation for the applicable batch\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result and analytical method are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePolypeptide Content:\u003c\/strong\u003e\n Net polypeptide content should be determined independently of chromatographic purity and interpreted alongside water, formulation and residual-solvent results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAggregation and Folding:\u003c\/strong\u003e\n Monomeric state, aggregation, folding and disulphide-bond integrity are separate quality attributes and are not established by a chromatographic purity percentage alone\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or LPS result, test method, reporting units and acceptance limit should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, chromatographic purity, net polypeptide content, structural integrity, aggregation, water content, residual solvent content, formulation components and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The 83-residue amino-acid sequence, N-terminal extension and arginine substitution should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified IGF-1 LR3 structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Polypeptide-content documentation – Net polypeptide content should be distinguished from chromatographic purity and interpreted alongside water, formulation and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Structural documentation – Folding, disulphide-bond integrity, monomeric state and aggregation should be assessed using appropriate product-specific analytical methods where required.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, acceptance criterion and reporting units.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting production, folding, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"igf-1-lr3-product-overview\"\u003e\n \u003cstrong\u003eIGF-1 LR3 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eIGF-1 LR3 research-grade polypeptide\u003c\/strong\u003e,\n also known as Long R3 IGF-I, is supplied for controlled scientific laboratory investigation, analytical method development, polypeptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and cell-culture reagent evaluation. The material comprises a defined sequence of 83 amino-acid residues containing a 13-residue N-terminal extension and an arginine substitution at position 3 of the mature IGF-I domain.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The reference IGF-1 LR3 structure is a single, non-glycosylated polypeptide chain containing three intramolecular disulphide bonds. Product identity, molecular mass, chromatographic purity, net polypeptide content, sequence integrity, terminal structure, folding, disulphide-bond integrity, aggregation, formulation composition, residual solvents, water content and bacterial endotoxin results should be confirmed using the applicable batch Certificate of Analysis and supporting analytical records.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to the total net polypeptide content of the vial. Similarly, a bacterial endotoxin or LPS result does not establish sterility, structural integrity, biological activity or the absence of other process-related impurities.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, biochemical, cell-culture and general laboratory work, the Regular IGF-1 LR3 specification remains highly suitable. The premium black-and-gold ULTIMATE IGF-1 LR3 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP029.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP029.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50022075793746,"sku":"PEP029","price":80.25,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022075826514,"sku":"PEP029","price":224.5,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022075859282,"sku":"PEP029","price":418.85,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022075892050,"sku":"PEP029","price":776.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022075924818,"sku":"PEP029","price":1789.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243415699794,"sku":"PEP029","price":932.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243416125778,"sku":"PEP029","price":1863.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243416617298,"sku":"PEP029","price":1739.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243417076050,"sku":"PEP029","price":3478.95,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648338907474,"sku":"PEP029U","price":313.85,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648338940242,"sku":"PEP029U","price":585.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648338973010,"sku":"PEP029U","price":1086.95,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648339005778,"sku":"PEP029U","price":2504.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648339038546,"sku":"PEP029U","price":1305.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648339071314,"sku":"PEP029U","price":2609.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648339136850,"sku":"PEP029U","price":2435.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766531379538,"sku":"PEP029U","price":4869.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-igf-1-lr3-peptide-uk-pure-fine-powder.png?v=1767865921"},{"product_id":"igf-1-des-peptide-uk","title":"IGF-1-DES - Research Grade Peptide","description":"\u003ch3 id=\"igf1-des-research-grade-polypeptide\"\u003e\n \u003cstrong\u003e\n IGF1-DES\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Polypeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade, sequence-defined 67-residue polypeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n DES(1–3) IGF-I structure lacking the N-terminal Gly-Pro-Glu tripeptide of full-length human IGF-I\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, polypeptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research polypeptides, proteins and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated nominal amount refers to the declared IGF1-DES content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-igf1-des-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-igf1-des-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n IGF1-DES\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE IGF1-DES range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of polypeptide purification and quality control. Following the standard production, folding and purification workflow, the finished IGF1-DES research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual product-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard production, folding and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM BATCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, biochemical, cell-culture and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade IGF1-DES product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of material quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE IGF1-DES remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, sequence, chromatographic purity, polypeptide content, molecular form, disulphide-bond integrity, aggregation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"igf1-des-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n IGF1-DES\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Scientific Description:\u003c\/strong\u003e\n DES(1–3) human insulin-like growth factor I\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n IGF-1 DES; DES IGF-I; DES(1–3) IGF-I; IGF-I (4–70); truncated human IGF-I\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Sequence-defined 67-residue polypeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Structural Form:\u003c\/strong\u003e\n Single-chain polypeptide containing three intramolecular disulphide bonds\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 67 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFull Amino-Acid Sequence:\u003c\/strong\u003e\n TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Origin:\u003c\/strong\u003e\n Residues 4–70 of mature human IGF-I\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDeleted N-Terminal Residues:\u003c\/strong\u003e\n Gly-Pro-Glu\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free threonine amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free alanine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Disulphide Bonds Using IGF1-DES Numbering:\u003c\/strong\u003e\n Cys\u003csup\u003e3\u003c\/sup\u003e–Cys\u003csup\u003e45\u003c\/sup\u003e,\n Cys\u003csup\u003e15\u003c\/sup\u003e–Cys\u003csup\u003e58\u003c\/sup\u003e and\n Cys\u003csup\u003e44\u003c\/sup\u003e–Cys\u003csup\u003e49\u003c\/sup\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePrimary CAS Number:\u003c\/strong\u003e\n 112603-35-7\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n AG0WVP88OA\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence-Derived Reduced-Chain Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e319\u003c\/sub\u003eH\u003csub\u003e501\u003c\/sub\u003eN\u003csub\u003e91\u003c\/sub\u003eO\u003csub\u003e96\u003c\/sub\u003eS\u003csub\u003e7\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Folded Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e319\u003c\/sub\u003eH\u003csub\u003e495\u003c\/sub\u003eN\u003csub\u003e91\u003c\/sub\u003eO\u003csub\u003e96\u003c\/sub\u003eS\u003csub\u003e7\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Explanation:\u003c\/strong\u003e\n Formation of the three reference intramolecular disulphide bonds removes six hydrogen atoms from the fully reduced polypeptide-chain formula\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eApproximate Molecular Weight:\u003c\/strong\u003e\n Approximately 7.37 kDa, with the reported value dependent upon whether the reduced or disulphide-bonded molecular form and the average or monoisotopic mass convention are used\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eProduction Method:\u003c\/strong\u003e\n The expression system, chemical synthesis route, purification procedure and folding process should be confirmed using the applicable supplier and batch documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTag Status:\u003c\/strong\u003e\n The presence or absence of any affinity tag, linker, terminal extension or additional residue should be confirmed using sequence and mass-spectrometry documentation for the applicable batch\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result and analytical method are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePolypeptide Content:\u003c\/strong\u003e\n Net polypeptide content should be determined independently of chromatographic purity and interpreted alongside water, formulation, counter-ion and residual-solvent results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAggregation and Folding:\u003c\/strong\u003e\n Monomeric state, aggregation, folding and disulphide-bond integrity are separate quality attributes and are not established by a chromatographic purity percentage alone\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or LPS result, test method, reporting units and acceptance limit should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, chromatographic purity, net polypeptide content, structural integrity, aggregation, water content, residual solvent content, formulation components and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The 67-residue amino-acid sequence and deletion of the N-terminal Gly-Pro-Glu tripeptide should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified IGF1-DES structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Polypeptide-content documentation – Net polypeptide content should be distinguished from chromatographic purity and interpreted alongside water, formulation and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Structural documentation – Folding, disulphide-bond integrity, monomeric state and aggregation should be assessed using appropriate product-specific analytical methods where required.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, acceptance criterion and reporting units.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting production, folding, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"igf1-des-product-overview\"\u003e\n \u003cstrong\u003eIGF1-DES Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eIGF1-DES research-grade polypeptide\u003c\/strong\u003e,\n also known as DES(1–3) IGF-I, is supplied for controlled scientific laboratory investigation, analytical method development, polypeptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and cell-culture reagent evaluation. The material comprises a defined sequence of 67 amino-acid residues corresponding to mature human IGF-I without its first three N-terminal residues, Gly-Pro-Glu.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The reference structure is a single polypeptide chain containing three intramolecular disulphide bonds. Product identity, molecular mass, chromatographic purity, net polypeptide content, sequence integrity, terminal structure, folding, disulphide-bond integrity, aggregation, formulation composition, residual solvents, water content and bacterial endotoxin results should be confirmed using the applicable batch Certificate of Analysis and supporting analytical records.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to the total net polypeptide content of the vial. Similarly, a bacterial endotoxin or LPS result does not establish sterility, structural integrity, biological activity or the absence of other process-related impurities.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, biochemical, cell-culture and general laboratory work, the Regular IGF1-DES specification remains highly suitable. The premium black-and-gold ULTIMATE IGF1-DES option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP030.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP030.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022110232914,"sku":"PEP030","price":80.5,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022110265682,"sku":"PEP030","price":232.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022110298450,"sku":"PEP030","price":434.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022110331218,"sku":"PEP030","price":805.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022110363986,"sku":"PEP030","price":1856.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243419107666,"sku":"PEP030","price":967.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243419861330,"sku":"PEP030","price":1934.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243420975442,"sku":"PEP030","price":1805.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243421958482,"sku":"PEP030","price":3609.5,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656973013330,"sku":"PEP030U","price":337.5,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656973046098,"sku":"PEP030U","price":628.5,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656973078866,"sku":"PEP030U","price":1167.95,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656973111634,"sku":"PEP030U","price":2692.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656973144402,"sku":"PEP030U","price":1402.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656973177170,"sku":"PEP030U","price":2804.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656973242706,"sku":"PEP030U","price":2617.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766531314002,"sku":"PEP030U","price":5233.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-igf-1-des-peptide-uk-pure-fine-powder.png?v=1767887080"},{"product_id":"buy-ipamorelin-uk","title":"IPAMORELIN - Research Grade Peptide","description":"\u003ch3 id=\"ipamorelin-research-grade-synthetic-pentapeptide\"\u003e\n \u003cstrong\u003e\n IPAMORELIN\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Synthetic Pentapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic pentapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined modified sequence comprising five amino-acid and non-proteinogenic amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated nominal amount refers to the declared Ipamorelin peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-ipamorelin-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-ipamorelin-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n IPAMORELIN\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE Ipamorelin range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished Ipamorelin research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM QUALITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced batch-specific quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade Ipamorelin product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE Ipamorelin remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, sequence, stereochemistry, chromatographic purity, peptide content, molecular form, counter-ion content, aggregation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"ipamorelin-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n IPAMORELIN\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Ipamorelin; NNC 26-0161; NNC-26-0161\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic modified pentapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Five amino-acid and non-proteinogenic amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n H-Aib-His-D-2-Nal-D-Phe-Lys-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eExpanded Sequence:\u003c\/strong\u003e\n 2-aminoisobutyryl-L-histidyl-3-(2-naphthyl)-D-alanyl-D-phenylalanyl-L-lysinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNon-Proteinogenic Residue:\u003c\/strong\u003e\n Aib denotes 2-aminoisobutyric acid, also known as 2-methylalanine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAromatic Residue:\u003c\/strong\u003e\n D-2-Nal denotes 3-(2-naphthyl)-D-alanine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStereochemical Features:\u003c\/strong\u003e\n Contains D-2-naphthylalanine and D-phenylalanine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free Aib amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal lysinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIpamorelin Free-Form CAS Number:\u003c\/strong\u003e\n 170851-70-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 9831659\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n Y9M3S784Z6\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Form Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e38\u003c\/sub\u003eH\u003csub\u003e49\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Form Average Molecular Weight:\u003c\/strong\u003e\n Approximately 711.86 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eInChIKey:\u003c\/strong\u003e\n NEHWBYHLYZGBNO-BVEPWEIPSA-N\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIpamorelin Acetate CAS Number:\u003c\/strong\u003e\n 1258196-85-8\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIpamorelin Acetate General Formula:\u003c\/strong\u003e\n C\u003csub\u003e38\u003c\/sub\u003eH\u003csub\u003e49\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e\n ·\n xCH\u003csub\u003e3\u003c\/sub\u003eCOOH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIpamorelin Acetate Molecular Weight:\u003c\/strong\u003e\n Dependent upon the measured acetate stoichiometry; refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is Ipamorelin free form, Ipamorelin acetate or another counter-ion form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Confirmation:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect the measured formula weight, water content and net peptide content of the supplied material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Confirmation:\u003c\/strong\u003e\n Product identity should be supported by sequence documentation and mass-spectrometry results consistent with the specified Ipamorelin molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAggregation and Impurity Control:\u003c\/strong\u003e\n Peptide aggregation, individual peptide-related impurities, synthesis-related impurities and process-related impurities are separate quality attributes and are not established by a chromatographic purity percentage alone\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or LPS result, analytical method, reporting units and acceptance limit should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, stereochemistry, chromatographic purity, net peptide content, aggregation, water content, residual solvent content, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The modified pentapeptide sequence, stereochemistry and molecular identity should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified Ipamorelin structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The free form, acetate form or other counter-ion form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, reporting units and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"ipamorelin-product-overview\"\u003e\n \u003cstrong\u003eIpamorelin Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eIpamorelin research-grade synthetic pentapeptide\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment and mass-spectrometry workflows. The material comprises a defined modified sequence of five residues incorporating 2-aminoisobutyric acid, D-2-naphthylalanine and D-phenylalanine, together with a C-terminal lysinamide.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, stereochemistry, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, aggregation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 170851-70-4, molecular formula C\u003csub\u003e38\u003c\/sub\u003eH\u003csub\u003e49\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e and molecular weight of approximately 711.86 g\/mol identify Ipamorelin free form. Where the supplied product is Ipamorelin acetate, the applicable batch documentation should instead identify the acetate form, acetate content and resulting batch-specific formula weight.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, investigative and general laboratory work, the Regular Ipamorelin specification remains highly suitable. The premium black-and-gold ULTIMATE Ipamorelin option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP031.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022155747666,"sku":"PEP031","price":9.5,"currency_code":"GBP","in_stock":false},{"title":"2mg - special order - 11mm Chromatography Vial (non standard)","offer_id":51137407713618,"sku":"PEP031","price":8.25,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022155780434,"sku":"PEP031","price":23.5,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022155813202,"sku":"PEP031","price":45.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022155845970,"sku":"PEP031","price":89.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022155878738,"sku":"PEP031","price":222.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243436998994,"sku":"PEP031","price":95.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243444175186,"sku":"PEP031","price":190.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243444830546,"sku":"PEP031","price":185.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243445158226,"sku":"PEP031","price":352.31,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656972456274,"sku":"PEP031U","price":33.85,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656972489042,"sku":"PEP031U","price":65.5,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656972521810,"sku":"PEP031U","price":129.25,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656972554578,"sku":"PEP031U","price":322.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656972587346,"sku":"PEP031U","price":138.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656972620114,"sku":"PEP031U","price":275.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656972685650,"sku":"PEP031U","price":268.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766531215698,"sku":"PEP031U","price":536.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-ipamorelin-uk-ultra-pure-research-peptide.png?v=1767887081"},{"product_id":"kisspeptin-10-peptide-research-grade","title":"KISSPEPTIN-10 - Research Grade Peptide","description":"\u003ch3 id=\"kisspeptin-10-research-grade-synthetic-decapeptide\"\u003e\n \u003cstrong\u003e\n KISSPEPTIN-10\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Synthetic Decapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic decapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined linear peptide sequence comprising ten amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n C-terminally amidated peptide structure\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated nominal amount refers to the declared Kisspeptin-10 peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-kisspeptin-10-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-kisspeptin-10-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n KISSPEPTIN-10\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE Kisspeptin-10 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished Kisspeptin-10 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM QUALITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced batch-specific quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade Kisspeptin-10 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE Kisspeptin-10 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, amino-acid sequence, terminal structure, chromatographic purity, peptide content, molecular form, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"kisspeptin-10-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n KISSPEPTIN-10\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Kisspeptin-10\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Human Kisspeptin-10; KP-10; Kp-10; human metastin (45–54); KISS1 peptide (112–121)\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic linear decapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Ten amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n H-Tyr-Asn-Trp-Asn-Ser-Phe-Gly-Leu-Arg-Phe-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n YNWNSFGLRF-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence-Based Chemical Name:\u003c\/strong\u003e\n L-tyrosyl-L-asparaginyl-L-tryptophyl-L-asparaginyl-L-seryl-L-phenylalanylglycyl-L-leucyl-L-arginyl-L-phenylalaninamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eHuman Protein Sequence Reference:\u003c\/strong\u003e\n Corresponds to residues 45–54 of human metastin and residues 112–121 of the human KISS1 precursor\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free tyrosine amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal phenylalaninamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 374675-21-5\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 25240297\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n FS1N52VS3S\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e63\u003c\/sub\u003eH\u003csub\u003e83\u003c\/sub\u003eN\u003csub\u003e17\u003c\/sub\u003eO\u003csub\u003e14\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 1302.45 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMonoisotopic Mass:\u003c\/strong\u003e\n Approximately 1301.6305 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is uncountered Kisspeptin-10, Kisspeptin-10 acetate, Kisspeptin-10 trifluoroacetate or another counter-ion form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Confirmation:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect the measured formula weight, water content and net peptide content of the supplied material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Confirmation:\u003c\/strong\u003e\n Product identity should be supported by sequence documentation and mass-spectrometry results consistent with the specified Kisspeptin-10 molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or LPS result, analytical method, reporting units and acceptance limit should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, amino-acid sequence, C-terminal amidation, chromatographic purity, net peptide content, water content, residual solvent content, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The ten-residue amino-acid sequence and C-terminal amidation should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified Kisspeptin-10 structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The free form, acetate form, trifluoroacetate form or other counter-ion form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, reporting units and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"kisspeptin-10-product-overview\"\u003e\n \u003cstrong\u003eKisspeptin-10 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eKisspeptin-10 research-grade synthetic decapeptide\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment and mass-spectrometry workflows. The material comprises a defined linear sequence of ten amino-acid residues with a free N-terminal tyrosine and a C-terminal phenylalaninamide.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, amino-acid sequence, terminal structure, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 374675-21-5, molecular formula C\u003csub\u003e63\u003c\/sub\u003eH\u003csub\u003e83\u003c\/sub\u003eN\u003csub\u003e17\u003c\/sub\u003eO\u003csub\u003e14\u003c\/sub\u003e and average molecular weight of approximately 1302.45 g\/mol describe the uncountered, C-terminally amidated Kisspeptin-10 molecular structure. Where the supplied material contains acetate, trifluoroacetate or another counter-ion, the applicable batch documentation should identify the counter-ion and its contribution to the total material mass.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, investigative and general laboratory work, the Regular Kisspeptin-10 specification remains highly suitable. The premium black-and-gold ULTIMATE Kisspeptin-10 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP032.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022178586962,"sku":"PEP032","price":12.85,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022178619730,"sku":"PEP032","price":28.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022178652498,"sku":"PEP032","price":51.85,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022178685266,"sku":"PEP032","price":94.5,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022178718034,"sku":"PEP032","price":217.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243446141266,"sku":"PEP032","price":113.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243446927698,"sku":"PEP032","price":226.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243447386450,"sku":"PEP032","price":211.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243447877970,"sku":"PEP032","price":422.85,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656971276626,"sku":"PEP032U","price":40.95,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656971309394,"sku":"PEP032U","price":74.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656971342162,"sku":"PEP032U","price":137.95,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656971374930,"sku":"PEP032U","price":315.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656971407698,"sku":"PEP032U","price":164.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656971440466,"sku":"PEP032U","price":328.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656971506002,"sku":"PEP032U","price":306.5,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766530920786,"sku":"PEP032U","price":612.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupexx-kisspeptin-10-peptide-ultra-pure-research-powder.png?v=1767887080"},{"product_id":"larazotide-acetate-research-peptide","title":"LARAZOTIDE ACETATE - Research Grade Peptide","description":"\u003ch3 id=\"larazotide-acetate-research-grade-synthetic-octapeptide\"\u003e\n \u003cstrong\u003e\n LARAZOTIDE ACETATE\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Synthetic Octapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic octapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined linear peptide sequence comprising eight amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied in the larazotide acetate chemical form where confirmed by the applicable batch Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content, acetate content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated nominal amount refers to the declared Larazotide Acetate content of a single vial, subject to the applicable batch documentation and stated assay basis. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-larazotide-acetate-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-larazotide-acetate-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n LARAZOTIDE ACETATE\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE Larazotide Acetate range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished Larazotide Acetate research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM BATCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade Larazotide Acetate product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE Larazotide Acetate remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, amino-acid sequence, chromatographic purity, peptide content, acetate content, molecular form, water content, residual solvents, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"larazotide-acetate-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n LARAZOTIDE ACETATE\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Larazotide acetate\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n AT-1001; Larazotide acetate salt; Larazotide monoacetate; Gly-Gly-Val-Leu-Val-Gln-Pro-Gly acetate\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Synthetic linear octapeptide acetate\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Eight amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence:\u003c\/strong\u003e\n H-Gly-Gly-Val-Leu-Val-Gln-Pro-Gly-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n GGVLVQPG\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence-Based Chemical Name:\u003c\/strong\u003e\n Glycylglycyl-L-valyl-L-leucyl-L-valyl-L-glutaminyl-L-prolylglycine acetate\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free glycine amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free glycine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eLarazotide Acetate CAS Number:\u003c\/strong\u003e\n 881851-50-9\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eLarazotide Acetate PubChem Compound Identifier:\u003c\/strong\u003e\n CID 44146842\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eLarazotide Acetate Unique Ingredient Identifier:\u003c\/strong\u003e\n FO8S2IW40N\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eLarazotide Acetate Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e34\u003c\/sub\u003eH\u003csub\u003e59\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e12\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Formula Presentation:\u003c\/strong\u003e\n C\u003csub\u003e32\u003c\/sub\u003eH\u003csub\u003e55\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e10\u003c\/sub\u003e\n ·\n C\u003csub\u003e2\u003c\/sub\u003eH\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eLarazotide Acetate Average Molecular Weight:\u003c\/strong\u003e\n Approximately 785.89 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eLarazotide Acetate Exact Mass:\u003c\/strong\u003e\n Approximately 785.4283 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Acetate Stoichiometry:\u003c\/strong\u003e\n The reference molecular formula represents one larazotide molecule associated with one acetic acid component\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Larazotide CAS Number:\u003c\/strong\u003e\n 258818-34-7\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Larazotide PubChem Compound Identifier:\u003c\/strong\u003e\n CID 9810532\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Larazotide Unique Ingredient Identifier:\u003c\/strong\u003e\n ZN3R5560ZV\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Larazotide Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e32\u003c\/sub\u003eH\u003csub\u003e55\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e10\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Larazotide Average Molecular Weight:\u003c\/strong\u003e\n Approximately 725.85 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net larazotide content should be distinguished from chromatographic purity and interpreted alongside acetate, water and residual-solvent results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial amount is calculated as total Larazotide Acetate material or as parent larazotide peptide equivalent\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAcetate-Content Specification:\u003c\/strong\u003e\n Measured acetate content and acetate-to-peptide ratio should be stated or supported by the applicable batch analytical documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should confirm that the supplied material is Larazotide Acetate rather than uncountered larazotide, a sodium salt or another counter-ion form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Confirmation:\u003c\/strong\u003e\n Product identity should be supported by sequence documentation and mass-spectrometry results consistent with the specified larazotide octapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or LPS result, analytical method, reporting units and acceptance limit should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, amino-acid sequence, chromatographic purity, net peptide content, acetate content, water content, residual solvents and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The eight-residue amino-acid sequence and terminal structures should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified Larazotide Acetate structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net larazotide content should be distinguished from chromatographic purity and interpreted alongside acetate, water and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Acetate-content documentation – Acetate identity, content and peptide-to-acetate ratio should be stated or supported where applicable.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The acetate form, parent peptide or another counter-ion form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, reporting units and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"larazotide-acetate-product-overview\"\u003e\n \u003cstrong\u003eLarazotide Acetate Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eLarazotide Acetate research-grade synthetic octapeptide\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment and mass-spectrometry workflows. The material comprises a defined linear sequence of eight amino-acid residues with a free glycine amino terminus and a free glycine carboxylic acid terminus.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, amino-acid sequence, terminal structure, chromatographic purity, net peptide content, acetate content, molecular form, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 881851-50-9, molecular formula C\u003csub\u003e34\u003c\/sub\u003eH\u003csub\u003e59\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e12\u003c\/sub\u003e and average molecular weight of approximately 785.89 g\/mol describe the reference Larazotide Acetate form containing one acetic acid component. The parent uncountered larazotide peptide has a different CAS number, molecular formula and molecular weight. The applicable batch documentation should therefore identify the chemical form and whether the stated vial content is expressed as total acetate material or parent peptide equivalent.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, investigative and general laboratory work, the Regular Larazotide Acetate specification remains highly suitable. The premium black-and-gold ULTIMATE Larazotide Acetate option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP034.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP034.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022206865746,"sku":"PEP034","price":109.5,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022206898514,"sku":"PEP034","price":254.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022206931282,"sku":"PEP034","price":474.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022206964050,"sku":"PEP034","price":880.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022206996818,"sku":"PEP034","price":2031.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243458396498,"sku":"PEP034","price":1058.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243459445074,"sku":"PEP034","price":2115.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243459674450,"sku":"PEP034","price":1974.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243460034898,"sku":"PEP034","price":3948.5,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656970752338,"sku":"PEP034U","price":369.85,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656970785106,"sku":"PEP034U","price":687.5,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656970817874,"sku":"PEP034U","price":1276.25,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656970850642,"sku":"PEP034U","price":2945.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656970883410,"sku":"PEP034U","price":1534.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656970916178,"sku":"PEP034U","price":3067.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656970981714,"sku":"PEP034U","price":2863.5,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766530888018,"sku":"PEP034U","price":5725.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-larazotide-acetate-research-peptide-ultra-pure-powder.png?v=1767865921"},{"product_id":"buy-l-carnitine-supplement-uk","title":"L-CARNITINE (Levocarnitine) - Research Grade Peptide","description":"\u003ch3 id=\"l-carnitine-levocarnitine-research-grade-biochemical-compound\"\u003e\n \u003cstrong\u003e\n L-CARNITINE (Levocarnitine)\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Biochemical Compound\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #ff2a00;\"\u003e\n \u003cstrong\u003e\n \u003cspan style=\"font-size: 10pt; font-family: Arial, sans-serif;\"\u003e\n For research purposes only.\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"font-size: 10pt; font-family: Arial, sans-serif;\"\u003e\n This product is supplied exclusively for scientific laboratory research and analytical purposes. It is not intended for human or animal use and must not be misused in any way that contravenes MHRA requirements or applicable laws.\n \u003c\/span\u003e\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade L-carnitine biochemical compound with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined L-enantiomer of carnitine with the specified R stereochemical configuration\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as measured dry laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, assay, chromatographic purity and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n L-carnitine, also known as levocarnitine, is a defined chiral biochemical compound rather than a peptide. Each vial contains measured dry laboratory material prepared to support consistent scientific handling, storage and analytical investigation. The stated nominal amount refers to the declared L-carnitine content of a single vial, subject to the applicable batch documentation. Where dissolution is required, the solvent, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-l-carnitine-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-l-carnitine-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n L-CARNITINE\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE L-Carnitine range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of purification and quality control. Following the standard production and purification process, the finished L-carnitine research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual structurally related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard production and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM QUALITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional chromatographic purification and enhanced batch-specific quality-control parameters.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, biochemical, formulation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade L-Carnitine product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of material quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE L-Carnitine remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, stereochemistry, assay, chromatographic purity, material content, molecular form, water content, residual solvents, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"l-carnitine-levocarnitine-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n L-Carnitine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Levocarnitine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n L-Carnitine; Levocarnitine; L-(-)-Carnitine; (-)-Carnitine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Chiral zwitterionic quaternary ammonium compound and beta-hydroxy betaine derivative\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIUPAC Name:\u003c\/strong\u003e\n (3R)-3-hydroxy-4-(trimethylazaniumyl)butanoate\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Systematic Description:\u003c\/strong\u003e\n (L-3-carboxy-2-hydroxypropyl)trimethylammonium inner salt\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStereochemical Configuration:\u003c\/strong\u003e\n R configuration at the single chiral centre\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Charge Form:\u003c\/strong\u003e\n Zwitterionic inner salt\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 541-15-1\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 10917\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n 0G389FZZ9M\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e7\u003c\/sub\u003eH\u003csub\u003e15\u003c\/sub\u003eNO\u003csub\u003e3\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 161.20 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eExact Mass:\u003c\/strong\u003e\n Approximately 161.1052 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eInChIKey:\u003c\/strong\u003e\n PHIQHXFUZVPYII-ZCFIWIBFSA-N\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry laboratory powder or lyophilised material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAssay Specification:\u003c\/strong\u003e\n The applicable assay result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChromatographic Purity:\u003c\/strong\u003e\n The applicable chromatographic result and analytical method are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChiral Identity:\u003c\/strong\u003e\n The supplied material should be confirmed as the L-carnitine or R-configured enantiomer using suitable supplier records or chiral analytical data\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The formula C\u003csub\u003e7\u003c\/sub\u003eH\u003csub\u003e15\u003c\/sub\u003eNO\u003csub\u003e3\u003c\/sub\u003e and molecular weight of approximately 161.20 g\/mol apply to the uncountered zwitterionic L-carnitine inner salt\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Salt Forms:\u003c\/strong\u003e\n L-carnitine hydrochloride, L-carnitine tartrate and other salt forms have different molecular formulae and molecular weights and should not be represented using the free-form identity\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater and Hydration:\u003c\/strong\u003e\n Water content, hydration state and loss on drying should be interpreted using the applicable batch analytical results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual Solvents:\u003c\/strong\u003e\n Any applicable residual-solvent results and acceptance criteria should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or LPS result, analytical method, reporting units and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, stereochemical identity, assay, chromatographic purity, water content, residual solvents, inorganic residues and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Identity documentation – Chemical identity, molecular formula and stereochemical configuration should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Assay documentation – The reported assay applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Chromatographic documentation – Chromatographic purity should be interpreted separately from assay, water content and total material content.\n \u003cbr\u003e\n\n ✓ Chiral identity documentation – Confirmation of the L-carnitine enantiomer should be supported by suitable supplier or analytical records.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The zwitterionic free form, hydrochloride, tartrate or another salt form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, reporting units and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting production, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"l-carnitine-levocarnitine-product-overview\"\u003e\n \u003cstrong\u003eL-Carnitine Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eL-Carnitine research-grade biochemical compound\u003c\/strong\u003e,\n also known as levocarnitine, is supplied for controlled scientific laboratory investigation, analytical method development, biochemical characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows, formulation studies and reference-material comparison. The material is the R-configured L-enantiomer of carnitine and exists as a zwitterionic quaternary ammonium inner salt.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, stereochemical identity, assay, chromatographic purity, molecular form, water content, residual solvents, inorganic residues, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 541-15-1, molecular formula C\u003csub\u003e7\u003c\/sub\u003eH\u003csub\u003e15\u003c\/sub\u003eNO\u003csub\u003e3\u003c\/sub\u003e and average molecular weight of approximately 161.20 g\/mol describe the uncountered zwitterionic L-carnitine inner salt. Where the supplied material is L-carnitine hydrochloride, L-carnitine tartrate or another salt form, the applicable batch documentation should identify the correct chemical form, molecular formula and formula weight.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, biochemical, formulation and general laboratory work, the Regular L-Carnitine specification remains highly suitable. The premium black-and-gold ULTIMATE L-Carnitine option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP033.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP033.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022221349202,"sku":"PEP033","price":26.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022221381970,"sku":"PEP033","price":60.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022221414738,"sku":"PEP033","price":111.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022221447506,"sku":"PEP033","price":206.25,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022221480274,"sku":"PEP033","price":476.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243455480146,"sku":"PEP033","price":248.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243456201042,"sku":"PEP033","price":495.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243456725330,"sku":"PEP033","price":462.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243456856402,"sku":"PEP033","price":924.85,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656970228050,"sku":"PEP033U","price":87.95,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656970260818,"sku":"PEP033U","price":161.25,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656970293586,"sku":"PEP033U","price":299.25,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656970326354,"sku":"PEP033U","price":690.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656970359122,"sku":"PEP033U","price":359.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656970391890,"sku":"PEP033U","price":718.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656970457426,"sku":"PEP033U","price":670.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766530822482,"sku":"PEP033U","price":1340.95,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-l-carnitine-supplement-uk-pure-fine-peptide-powder.png?v=1767865921"},{"product_id":"ll-37-peptide-uk","title":"LL-37 - Research Grade Peptide","description":"\u003ch3 id=\"ll-37-research-grade-37-residue-peptide\"\u003e\n \u003cstrong\u003e\n LL-37\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade 37-Residue Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic LL-37 peptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined linear sequence comprising 37 amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Human cathelicidin-derived peptide corresponding to residues 134–170 of the CAMP precursor\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated nominal amount refers to the declared LL-37 peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-ll-37-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-ll-37-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n LL-37\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE LL-37 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished LL-37 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM QUALITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification and an enhanced batch-specific quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, biochemical, peptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade LL-37 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE LL-37 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, amino-acid sequence, terminal structure, chromatographic purity, peptide content, molecular form, counter-ion content, aggregation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"ll-37-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n LL-37\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Ropocamptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Cathelicidin LL-37; human LL-37; human cathelicidin-derived LL-37; antimicrobial peptide LL-37; hCAP18-derived LL-37\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic linear 37-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 37 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFull Amino-Acid Sequence:\u003c\/strong\u003e\n Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n [LL-37, 37 aa]\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eHuman Precursor Reference:\u003c\/strong\u003e\n Corresponds to residues 134–170 of the human cathelicidin antimicrobial peptide precursor, CAMP or hCAP18\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free leucine amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free serine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None; the LL-37 sequence contains no cysteine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 154947-66-7\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 16198951\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n 3DD771JO2H\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e205\u003c\/sub\u003eH\u003csub\u003e340\u003c\/sub\u003eN\u003csub\u003e60\u003c\/sub\u003eO\u003csub\u003e53\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 4493.3 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eApproximate Molecular Size:\u003c\/strong\u003e\n 4.49 kDa\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the uncountered LL-37 peptide with free amino and carboxylic acid termini, without formulation excipients, residual water or additional counter-ions\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net LL-37 peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is uncountered LL-37, LL-37 acetate, LL-37 trifluoroacetate or another counter-ion form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Confirmation:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect the recorded material mass, water content and net peptide content of the supplied laboratory material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Confirmation:\u003c\/strong\u003e\n Product identity should be supported by sequence documentation and mass-spectrometry results consistent with the specified 37-residue LL-37 structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAggregation and Structural State:\u003c\/strong\u003e\n Aggregation, oligomerisation and secondary structure are separate quality attributes and are not established by a chromatographic purity percentage alone\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or LPS result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, amino-acid sequence, terminal structure, chromatographic purity, net peptide content, aggregation, water content, residual solvent content, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The complete 37-residue amino-acid sequence and terminal structures should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified LL-37 structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The free peptide, acetate form, trifluoroacetate form or other counter-ion form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"ll-37-product-overview\"\u003e\n \u003cstrong\u003eLL-37 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eLL-37 research-grade synthetic peptide\u003c\/strong\u003e,\n also known as ropocamptide or cathelicidin LL-37, is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and biochemical research. The material comprises a defined linear sequence of 37 amino-acid residues with a free N-terminal leucine and a free C-terminal serine carboxylic acid.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n LL-37 corresponds to the C-terminal 37-residue peptide derived from the human cathelicidin antimicrobial peptide precursor, commonly identified as CAMP or hCAP18. The LL-37 research material should not be confused with the complete human cathelicidin precursor protein, which is a larger biological molecule with a different sequence, molecular formula and molecular weight.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, amino-acid sequence, terminal structure, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, aggregation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 154947-66-7, molecular formula C\u003csub\u003e205\u003c\/sub\u003eH\u003csub\u003e340\u003c\/sub\u003eN\u003csub\u003e60\u003c\/sub\u003eO\u003csub\u003e53\u003c\/sub\u003e and average molecular weight of approximately 4493.3 g\/mol describe the uncountered LL-37 peptide. Where the supplied laboratory material contains acetate, trifluoroacetate or another counter-ion, the applicable batch documentation should identify the counter-ion and its contribution to the total material mass.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, biochemical, peptide-characterisation and general laboratory work, the Regular LL-37 specification remains highly suitable. The premium black-and-gold ULTIMATE LL-37 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP035.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP035.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022242353490,"sku":"PEP035","price":30.85,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022242386258,"sku":"PEP035","price":58.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022242419026,"sku":"PEP035","price":108.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022242451794,"sku":"PEP035","price":200.25,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022242484562,"sku":"PEP035","price":461.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243472748882,"sku":"PEP035","price":240.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243473273170,"sku":"PEP035","price":480.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243473666386,"sku":"PEP035","price":448.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243473895762,"sku":"PEP035","price":896.95,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648338022738,"sku":"PEP035U","price":81.5,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648338055506,"sku":"PEP035U","price":151.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648338088274,"sku":"PEP035U","price":280.85,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648338121042,"sku":"PEP035U","price":645.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648338153810,"sku":"PEP035U","price":336.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648338186578,"sku":"PEP035U","price":672.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648338252114,"sku":"PEP035U","price":627.5,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766530789714,"sku":"PEP035U","price":1254.95,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-ll-37-peptide-uk-pure-fine-powder.png?v=1767887081"},{"product_id":"matrixyl-peptide-uk","title":"MATRIXYL - Research Grade Peptide","description":"\u003ch3 id=\"matrixyl-palmitoyl-pentapeptide-4-research-grade-lipopeptide\"\u003e\n \u003cstrong\u003e\n MATRIXYL\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Palmitoylated Pentapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade Palmitoyl Pentapeptide-4 laboratory material with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined KTTKS pentapeptide sequence containing an N-terminal palmitoyl modification\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, lipopeptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n MATRIXYL, as identified in this product listing, refers to Palmitoyl Pentapeptide-4: a synthetic lipopeptide comprising the pentapeptide sequence Lys-Thr-Thr-Lys-Ser modified with an N-terminal palmitoyl group. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage and analytical investigation. The stated nominal amount refers to the declared Palmitoyl Pentapeptide-4 content of a single vial, subject to the applicable batch documentation. Where dissolution is required, the solvent, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-matrixyl-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-matrixyl-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n MATRIXYL\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Lipopeptide Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE MATRIXYL range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of lipopeptide purification and quality control. Following the standard peptide synthesis, palmitoylation and purification process, the finished Palmitoyl Pentapeptide-4 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, acylation-related, synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard lipopeptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM IDENTITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional lipopeptide purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, formulation, chromatographic and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade MATRIXYL product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of lipopeptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE MATRIXYL remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, amino-acid sequence, palmitoylation status, chromatographic purity, lipopeptide content, molecular form, counter-ion content, aggregation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"matrixyl-palmitoyl-pentapeptide-4-chemical-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n MATRIXYL\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Palmitoyl Pentapeptide-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Matrixyl; Pal-KTTKS; Palmitoyl Pentapeptide-3; Palmitoyl Pentapeptide; Lipopentapeptide 3\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic N-palmitoylated pentapeptide and lipopeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence Length:\u003c\/strong\u003e\n Five amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCore Peptide Sequence:\u003c\/strong\u003e\n Lys-Thr-Thr-Lys-Ser\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n KTTKS\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Structural Shorthand:\u003c\/strong\u003e\n Pal-Lys-Thr-Thr-Lys-Ser-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Modification:\u003c\/strong\u003e\n The N-terminal lysine residue is acylated with a hexadecanoyl or palmitoyl group\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free serine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSystematic Chemical Name:\u003c\/strong\u003e\n N\u003csup\u003e2\u003c\/sup\u003e-(1-oxohexadecyl)-L-lysyl-L-threonyl-L-threonyl-L-lysyl-L-serine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 214047-00-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 9897237\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n KK181SM5JG\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEuropean Community Number:\u003c\/strong\u003e\n 606-757-9\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e39\u003c\/sub\u003eH\u003csub\u003e75\u003c\/sub\u003eN\u003csub\u003e7\u003c\/sub\u003eO\u003csub\u003e10\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 802.05 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eInChIKey:\u003c\/strong\u003e\n WSGCRSMLXFHGRM-DEVHWETNSA-N\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the uncountered Palmitoyl Pentapeptide-4 molecular structure without formulation excipients, residual water, counter-ions or solvates\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eProduct-Identity Clarification:\u003c\/strong\u003e\n This listing describes the single Palmitoyl Pentapeptide-4 substance corresponding to CAS number 214047-00-4 and should not be interpreted as describing an unspecified multi-ingredient peptide blend\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eLipopeptide-Content Specification:\u003c\/strong\u003e\n Net Palmitoyl Pentapeptide-4 content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion, residual-solvent and formulation results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePalmitoylation Confirmation:\u003c\/strong\u003e\n Product identity should confirm the presence and position of the N-terminal palmitoyl modification using suitable mass-spectrometry or equivalent analytical data\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence Confirmation:\u003c\/strong\u003e\n The KTTKS peptide sequence and terminal structures should be confirmed using the applicable supplier and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is the uncountered lipopeptide, an acetate form, a trifluoroacetate form or another counter-ion or solvate form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Confirmation:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect the total measured material mass and net lipopeptide content of the supplied laboratory material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage, palmitoylation and chromatographic purification should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Unmodified KTTKS, incompletely synthesised peptide sequences, deletion sequences, unreacted palmitic acid and other acylation-related or process-related impurities are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or LPS result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, peptide sequence, palmitoylation status, chromatographic purity, net lipopeptide content, aggregation, water content, residual solvent content, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The KTTKS pentapeptide sequence and terminal structures should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Palmitoylation documentation – The N-terminal palmitoyl modification should be supported by appropriate molecular-identity data.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified Palmitoyl Pentapeptide-4 structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Lipopeptide-content documentation – Net Palmitoyl Pentapeptide-4 content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The uncountered lipopeptide, acetate form, trifluoroacetate form or other chemical form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, palmitoylation, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"matrixyl-palmitoyl-pentapeptide-4-product-overview\"\u003e\n \u003cstrong\u003eMATRIXYL Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eMATRIXYL research-grade Palmitoyl Pentapeptide-4\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, lipopeptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows, formulation studies and reference-material comparison. The material comprises the defined KTTKS pentapeptide sequence modified with an N-terminal palmitoyl group.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The palmitoyl modification substantially changes the physicochemical character of the underlying KTTKS pentapeptide and should therefore be confirmed as part of molecular-identity testing. Product identity, peptide sequence, palmitoylation status, chromatographic purity, net lipopeptide content, molecular form, counter-ion content, water content, residual solvents, aggregation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 214047-00-4, molecular formula C\u003csub\u003e39\u003c\/sub\u003eH\u003csub\u003e75\u003c\/sub\u003eN\u003csub\u003e7\u003c\/sub\u003eO\u003csub\u003e10\u003c\/sub\u003e and average molecular weight of approximately 802.05 g\/mol describe the uncountered Palmitoyl Pentapeptide-4 structure. Where the supplied laboratory material contains acetate, trifluoroacetate, residual water, another counter-ion or formulation excipients, the applicable batch documentation should identify their contribution to the total material mass.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to the total net Palmitoyl Pentapeptide-4 content of the vial. Similarly, a bacterial endotoxin or LPS result does not establish sterility, molecular identity, correct palmitoylation, peptide-sequence integrity or the absence of every process-related impurity.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, formulation, chromatographic and general laboratory work, the Regular MATRIXYL specification remains highly suitable. The premium black-and-gold ULTIMATE MATRIXYL option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP036.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP036.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022259654994,"sku":"PEP036","price":7.5,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022259687762,"sku":"PEP036","price":17.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022259720530,"sku":"PEP036","price":31.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022259753298,"sku":"PEP036","price":57.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022259786066,"sku":"PEP036","price":130.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51243483595090,"sku":"PEP036","price":68.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51243484152146,"sku":"PEP036","price":135.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51243484381522,"sku":"PEP036","price":126.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51243485069650,"sku":"PEP036","price":252.25,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648337727826,"sku":"PEP036U","price":23.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648337760594,"sku":"PEP036U","price":43.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648337793362,"sku":"PEP036U","price":79.85,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648337826130,"sku":"PEP036U","price":182.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648337858898,"sku":"PEP036U","price":95.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648337891666,"sku":"PEP036U","price":189.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648337957202,"sku":"PEP036U","price":177.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766530658642,"sku":"PEP036U","price":353.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-matrixyl-peptide-uk-pure-fine-research-powder.png?v=1767887080"},{"product_id":"buy-mechano-growth-factor-research-peptide","title":"MGF (MECHANO GROWTH FACTOR) - Research Grade Peptide","description":"\u003ch3 id=\"mgf-mechano-growth-factor-research-grade-e-domain-peptide\"\u003e\n \u003cstrong\u003e\n MGF (MECHANO GROWTH FACTOR)\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade 24-Residue E-Domain Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e \n\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic MGF E-domain peptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined peptide corresponding to the 24-residue C-terminal E-domain sequence associated with human IGF-1Ec\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Non-PEGylated peptide presentation unless expressly stated otherwise in the applicable batch documentation\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, amino-acid sequence, terminal form, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated nominal amount refers to the declared MGF peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT MGF IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 19px 21px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 8px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.4px;\n text-transform: uppercase;\n \"\u003e\n Important Product Identity Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n This PEP039 listing is intended to describe the\n \u003cstrong\u003enon-PEGylated synthetic 24-residue MGF E-domain research peptide\u003c\/strong\u003e.\n MGF must not be represented using the CAS number, molecular formula or molecular weight assigned to GHRP-6.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n The applicable batch Certificate of Analysis should confirm the complete amino-acid sequence, stereochemical configuration, C-terminal free-acid or amide form, counter-ion content and measured molecular mass. Full-length IGF-1Ec, C-terminally amidated MGF, stereochemically modified MGF and PEGylated MGF are distinct molecular materials and should not be described as chemically interchangeable.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT MGF IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-mgf-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-mgf-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n MGF\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE MGF range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished MGF research peptide undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, deletion-sequence, synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard MGF peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM MOLECULAR IDENTITY CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification, enhanced endotoxin control and supporting batch-specific molecular-identity documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade MGF product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE MGF remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, amino-acid sequence, stereochemistry, terminal structure, chromatographic purity, peptide content, molecular form, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"mgf-mechano-growth-factor-chemical-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n MGF (MECHANO GROWTH FACTOR)\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Product Description:\u003c\/strong\u003e\n Synthetic human MGF 24-residue E-domain research peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n MGF; Mechano Growth Factor; MGF E-domain peptide; MGF-24aa-E peptide; human IGF-1Ec E-domain peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic linear 24-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 24 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Human Sequence:\u003c\/strong\u003e\n Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Reference Sequence:\u003c\/strong\u003e\n YQPPSTNKNTKSQRRKGSTFEEHK\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Origin:\u003c\/strong\u003e\n Corresponds to the distinctive C-terminal E-domain sequence associated with the human IGF-1Ec splice variant\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free tyrosine amino terminus unless otherwise stated in the applicable batch documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Batch-specific; the applicable Certificate of Analysis must identify whether the terminal lysine is supplied as a free carboxylic acid or C-terminal amide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Free-Acid Sequence:\u003c\/strong\u003e\n H-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCalculated Free-Acid Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e121\u003c\/sub\u003eH\u003csub\u003e194\u003c\/sub\u003eN\u003csub\u003e40\u003c\/sub\u003eO\u003csub\u003e40\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCalculated Free-Acid Average Molecular Weight:\u003c\/strong\u003e\n Approximately 2849.08 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference C-Terminal Amide Sequence:\u003c\/strong\u003e\n H-Tyr-Gln-Pro-Pro-Ser-Thr-Asn-Lys-Asn-Thr-Lys-Ser-Gln-Arg-Arg-Lys-Gly-Ser-Thr-Phe-Glu-Glu-His-Lys-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCalculated C-Terminal Amide Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e121\u003c\/sub\u003eH\u003csub\u003e195\u003c\/sub\u003eN\u003csub\u003e41\u003c\/sub\u003eO\u003csub\u003e39\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCalculated C-Terminal Amide Average Molecular Weight:\u003c\/strong\u003e\n Approximately 2848.09 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMGF Reference Substance UNII:\u003c\/strong\u003e\n Q86M4KXC2P\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminally Amidated MGF Reference Substance UNII:\u003c\/strong\u003e\n Y65LH7J9BL\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n The exact CAS number should be confirmed against the complete sequence, stereochemistry and terminal structure of the material supplied; CAS number 87616-84-0 is not applicable to MGF\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePEG Status:\u003c\/strong\u003e\n This listing describes non-PEGylated MGF unless PEG conjugation, PEG molecular weight, conjugation site and polydispersity are expressly stated in the applicable batch documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFull-Length IGF-1Ec Distinction:\u003c\/strong\u003e\n The isolated 24-residue MGF E-domain peptide is not chemically identical to the larger full-length IGF-1Ec precursor or propeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence-Variant Control:\u003c\/strong\u003e\n Alternative MGF-related research constructs may contain an arginine rather than histidine near the C-terminus, D-arginine substitutions, terminal amidation or other stabilising modifications\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStereochemical Confirmation:\u003c\/strong\u003e\n Mass spectrometry alone does not normally distinguish L-arginine from D-arginine residues; any D-amino-acid substitutions should therefore be supported by synthesis records or suitable stereochemical analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net MGF peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion, residual-solvent and formulation results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The product specification should state whether the declared vial amount is expressed as net MGF peptide, total salt-form material or total formulated lyophilised material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Confirmation:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect the total material mass, calculated molecular weight and net peptide content of the supplied laboratory material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The complete 24-residue amino-acid sequence should be confirmed using the applicable synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTerminal-Structure Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should establish whether the C-terminal lysine is present as the free acid or amide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the exact sequence and terminal form stated for the applicable batch\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely deprotected material, oxidation products, stereochemical impurities and other synthesis-related or process-related impurities are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or LPS result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, amino-acid sequence, stereochemistry, terminal structure, chromatographic purity, net peptide content, aggregation, water content, residual solvent content, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The complete 24-residue amino-acid sequence should be confirmed using the applicable batch and synthesis records.\n \u003cbr\u003e\n\n ✓ Terminal-structure documentation – The free-acid or C-terminal amide form should be identified clearly in the applicable batch documentation.\n \u003cbr\u003e\n\n ✓ Stereochemical documentation – Any D-amino-acid substitutions should be declared and supported by appropriate production or analytical records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the stated MGF construct.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net MGF peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ PEG-status documentation – The material should be identified expressly as non-PEGylated or PEGylated, with the PEG specification stated where applicable.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"mgf-mechano-growth-factor-product-overview\"\u003e\n \u003cstrong\u003eMGF Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eMGF research-grade 24-residue E-domain peptide\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and reference-material comparison. The product is intended to represent the distinctive C-terminal E-domain sequence associated with the human IGF-1Ec splice variant.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The term MGF is used inconsistently across scientific literature and commercial catalogues. It may describe the IGF-1Ec transcript, a larger precursor protein, a synthetic 24-residue E-domain peptide, a C-terminally amidated analogue, a stereochemically modified research peptide or a PEGylated derivative. This PEP039 listing is intended specifically for the non-PEGylated 24-residue peptide construct identified in the applicable batch documentation.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Product identity, amino-acid sequence, stereochemical configuration, terminal structure, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, aggregation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis. Chromatographic purity should not automatically be interpreted as equivalent to the total net peptide content of the vial.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The reference human sequence\n \u003cstrong\u003eYQPPSTNKNTKSQRRKGSTFEEHK\u003c\/strong\u003e\n has a calculated molecular weight of approximately 2849.08 g\/mol when represented with free amino and carboxylic acid termini. The corresponding C-terminal amide has a calculated molecular weight of approximately 2848.09 g\/mol. The applicable PEP039 Certificate of Analysis should identify which terminal form is actually supplied.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The MGF research peptide described here is not GHRP-6, is not full-length IGF-1Ec and is not PEG-MGF. Those materials have different molecular structures, analytical masses and product specifications and should be maintained as separate catalogue identities.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, the Regular MGF specification remains highly suitable. The premium black-and-gold ULTIMATE MGF option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP039.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP039.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022331875666,"sku":"PEP039","price":17.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022331908434,"sku":"PEP039","price":38.5,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022331941202,"sku":"PEP039","price":71.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022331973970,"sku":"PEP039","price":131.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022332006738,"sku":"PEP039","price":302.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51256681988434,"sku":"PEP039","price":158.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51256685527378,"sku":"PEP039","price":315.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51256687231314,"sku":"PEP039","price":294.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51256689787218,"sku":"PEP039","price":587.5,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648336843090,"sku":"PEP039U","price":53.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648336875858,"sku":"PEP039U","price":99.5,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648336908626,"sku":"PEP039U","price":183.25,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648336941394,"sku":"PEP039U","price":423.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648336974162,"sku":"PEP039U","price":220.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648337006930,"sku":"PEP039U","price":440.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648337072466,"sku":"PEP039U","price":411.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766529839442,"sku":"PEP039U","price":821.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-mechano-growth-factor-pure-fine-peptide-powder.png?v=1767887108"},{"product_id":"buy-n-acetyl-epitalon-online","title":"N-ACETYL EPITALON - Research Grade Peptide","description":"\u003ch3 id=\"n-acetyl-epitalon-research-grade-n-acetylated-tetrapeptide\"\u003e\n \u003cstrong\u003e\n N-ACETYL EPITALON\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade N-Acetylated Tetrapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade N-acetylated tetrapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined Ala-Glu-Asp-Gly tetrapeptide sequence containing a covalent N-terminal acetyl modification\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Free carboxylic acid C-terminal structure unless expressly stated otherwise in the applicable batch documentation\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated nominal amount refers to the declared N-Acetyl Epitalon peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT PRODUCT IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 19px 21px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 8px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.4px;\n text-transform: uppercase;\n \"\u003e\n Important Molecular Identity Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n This PEP041 listing describes\n \u003cstrong\u003eN-Acetyl Epitalon with the structure Ac-Ala-Glu-Asp-Gly-OH\u003c\/strong\u003e.\n The N-terminal acetyl group is covalently attached to the peptide and is not the same as an acetate counter-ion or acetate salt.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n N-Acetyl Epitalon is chemically distinct from unmodified Epitalon,\n H-Ala-Glu-Asp-Gly-OH, and from N-Acetyl Epitalon Amide,\n Ac-Ala-Glu-Asp-Gly-NH\u003csub\u003e2\u003c\/sub\u003e. The complete sequence, terminal structure, molecular formula and measured molecular mass should agree with the applicable batch Certificate of Analysis.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT PRODUCT IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-n-acetyl-epitalon-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-n-acetyl-epitalon-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n N-ACETYL EPITALON\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE N-Acetyl Epitalon range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis, N-terminal acetylation and purification process, the finished N-Acetyl Epitalon research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, acetylation-related, synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide synthesis and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM BATCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade N-Acetyl Epitalon product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE N-Acetyl Epitalon remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, amino-acid sequence, N-terminal acetylation, C-terminal structure, chromatographic purity, peptide content, molecular form, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"n-acetyl-epitalon-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n N-ACETYL EPITALON\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n N-Acetyl Epitalon\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n N-Acetyl Epithalon; N-Acetyl AEDG; Ac-AEDG-OH; N-Acetylated Epitalon\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic N-terminally acetylated linear tetrapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Four amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCore Peptide Sequence:\u003c\/strong\u003e\n Ala-Glu-Asp-Gly\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Core Sequence:\u003c\/strong\u003e\n AEDG\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Structural Shorthand:\u003c\/strong\u003e\n Ac-Ala-Glu-Asp-Gly-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eModified Sequence Shorthand:\u003c\/strong\u003e\n Ac-AEDG-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence-Based Chemical Name:\u003c\/strong\u003e\n N-acetyl-L-alanyl-L-alpha-glutamyl-L-alpha-aspartylglycine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Covalently N-acetylated alanine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free glycine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAcetylation Clarification:\u003c\/strong\u003e\n The N-terminal acetyl group is part of the covalent peptide structure and should not be confused with an acetate counter-ion\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Registry Number:\u003c\/strong\u003e\n No verified CAS Registry Number was located for this exact N-acetyl free-acid structure in the referenced FDA Global Substance Registration System-linked PubChem identity record\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 171390141\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n UXR7AF6R4F\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e16\u003c\/sub\u003eH\u003csub\u003e24\u003c\/sub\u003eN\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e10\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 432.38 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eExact Mass:\u003c\/strong\u003e\n Approximately 432.1492 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eInChIKey:\u003c\/strong\u003e\n QXYAPAXZRKPASL-HGNGGELXSA-N\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the neutral N-acetylated peptide with a free C-terminal carboxylic acid, without counter-ions, residual water, solvents or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Epitalon Cross-Reference:\u003c\/strong\u003e\n Unmodified Epitalon has the structure H-Ala-Glu-Asp-Gly-OH, CAS number 307297-39-8, molecular formula C\u003csub\u003e14\u003c\/sub\u003eH\u003csub\u003e22\u003c\/sub\u003eN\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e9\u003c\/sub\u003e and molecular weight approximately 390.35 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent-CAS Clarification:\u003c\/strong\u003e\n CAS number 307297-39-8 identifies unmodified Epitalon and should not be assigned to N-Acetyl Epitalon\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAmidated-Derivative Distinction:\u003c\/strong\u003e\n N-Acetyl Epitalon Amide or N-Acetyl Epithalonamide has the structure Ac-Ala-Glu-Asp-Gly-NH\u003csub\u003e2\u003c\/sub\u003e and is chemically distinct from the free-acid material described on this page\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEpitalon Acetate Distinction:\u003c\/strong\u003e\n Epitalon acetate is also a separate material and should not be confused with covalently N-acetylated Epitalon\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net N-Acetyl Epitalon peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion, residual-solvent and formulation results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The complete four-residue AEDG sequence should be confirmed using the applicable synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Modification Confirmation:\u003c\/strong\u003e\n Product identity should confirm the covalent N-terminal acetyl group using appropriate mass-spectrometry or equivalent analytical data\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Confirmation:\u003c\/strong\u003e\n The applicable molecular-identity documentation should confirm that the glycine terminus is present as a free carboxylic acid rather than a C-terminal amide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the specified N-Acetyl Epitalon molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied laboratory material is the neutral free-acid structure, an additional salt or counter-ion form, or a formulated lyophilised preparation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Confirmation:\u003c\/strong\u003e\n Sodium, ammonium, acetate, trifluoroacetate or another counter-ion may affect the total measured material mass and net peptide content of the supplied laboratory material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, acetylation, cleavage and chromatographic purification should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Unmodified Epitalon, incompletely acetylated material, deletion sequences, truncated peptides, incompletely deprotected material and other synthesis-related or process-related impurities are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or LPS result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, amino-acid sequence, N-terminal acetylation, C-terminal structure, chromatographic purity, net peptide content, water content, residual solvents, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The complete AEDG tetrapeptide sequence should be confirmed using the applicable batch and synthesis records.\n \u003cbr\u003e\n\n ✓ N-terminal modification documentation – Covalent N-terminal acetylation should be supported by appropriate molecular-identity data.\n \u003cbr\u003e\n\n ✓ C-terminal structure documentation – The free carboxylic acid terminus should be distinguished from a C-terminally amidated derivative.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified N-Acetyl Epitalon structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net N-Acetyl Epitalon content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The neutral free-acid structure, additional salt form or formulated material should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or LPS result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, N-terminal acetylation, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"n-acetyl-epitalon-product-overview\"\u003e\n \u003cstrong\u003eN-Acetyl Epitalon Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eN-Acetyl Epitalon research-grade synthetic tetrapeptide\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, modified peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and reference-material comparison. The material comprises the defined Ala-Glu-Asp-Gly tetrapeptide sequence containing a covalently attached N-terminal acetyl group and a free C-terminal carboxylic acid.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The N-terminal acetyl modification changes the molecular identity and formula relative to unmodified Epitalon. Product identity testing should therefore distinguish N-Acetyl Epitalon from unmodified Epitalon, incompletely acetylated material, N-Acetyl Epitalon Amide and any additional salt or counter-ion form.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, amino-acid sequence, N-terminal acetylation, C-terminal structure, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The molecular formula C\u003csub\u003e16\u003c\/sub\u003eH\u003csub\u003e24\u003c\/sub\u003eN\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e10\u003c\/sub\u003e and average molecular weight of approximately 432.38 g\/mol describe N-Acetyl Epitalon with the structure Ac-Ala-Glu-Asp-Gly-OH. CAS number 307297-39-8, formula C\u003csub\u003e14\u003c\/sub\u003eH\u003csub\u003e22\u003c\/sub\u003eN\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e9\u003c\/sub\u003e and molecular weight approximately 390.35 g\/mol describe unmodified Epitalon and should not be applied to this N-acetylated product.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The term “N-acetyl” describes a covalent modification to the peptide terminus and does not establish that the supplied material is an acetate salt. Any additional acetate, trifluoroacetate, sodium, ammonium or other counter-ion content should be identified separately in the applicable batch documentation.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net peptide content. Likewise, a bacterial endotoxin or LPS result does not establish sterility, molecular identity, correct N-terminal acetylation, C-terminal structure or the absence of every synthesis-related and process-related impurity.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, chromatographic, modified peptide-characterisation and general laboratory work, the Regular N-Acetyl Epitalon specification remains highly suitable. The premium black-and-gold ULTIMATE N-Acetyl Epitalon option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP041.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP041.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022362743122,"sku":"PEP041","price":12.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022362775890,"sku":"PEP041","price":27.25,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022362808658,"sku":"PEP041","price":51.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022362841426,"sku":"PEP041","price":94.25,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022362874194,"sku":"PEP041","price":216.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51256821154130,"sku":"PEP041","price":113.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51256821580114,"sku":"PEP041","price":225.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51256822661458,"sku":"PEP041","price":210.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51256823415122,"sku":"PEP041","price":420.95,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648336548178,"sku":"PEP041U","price":38.95,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648336580946,"sku":"PEP041U","price":71.95,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648336613714,"sku":"PEP041U","price":132.85,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648336646482,"sku":"PEP041U","price":303.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648336679250,"sku":"PEP041U","price":158.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648336712018,"sku":"PEP041U","price":315.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648336777554,"sku":"PEP041U","price":294.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766529773906,"sku":"PEP041U","price":588.85,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-n-acetyl-epitalon-online-pure-peptide-powder.png?v=1767887108"},{"product_id":"buy-orexin-a-peptide-uk","title":"OREXIN A - Research Grade Peptide","description":"\u003ch3 id=\"orexin-a-research-grade-33-residue-peptide\"\u003e\n \u003cstrong\u003e\n OREXIN A\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade 33-Residue Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade Orexin A peptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined mature peptide sequence comprising 33 amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n N-terminal pyroglutamate, C-terminal amide and two defined intramolecular disulphide bridges\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated nominal amount refers to the declared Orexin A peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-orexin-a-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-orexin-a-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n OREXIN A\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE Orexin A range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard production, disulphide-formation and purification workflow, the finished Orexin A research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard peptide and disulphide-formation workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM STRUCTURAL CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade Orexin A product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE Orexin A remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, amino-acid sequence, terminal modifications, disulphide-bond connectivity, chromatographic purity, peptide content, molecular form, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"orexin-a-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n OREXIN A\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Technical Name:\u003c\/strong\u003e\n Orexin-A\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Hypocretin-1; HCRT-1; Hcrt1; Orexin A\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Sequence-defined 33-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 33 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Modified Peptide Sequence:\u003c\/strong\u003e\n pGlu-Pro-Leu-Pro-Asp-Cys-Cys-Arg-Gln-Lys-Thr-Cys-Ser-Cys-Arg-Leu-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eModified Sequence Shorthand:\u003c\/strong\u003e\n pGlu-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnmodified Precursor-Encoded Sequence:\u003c\/strong\u003e\n Gln-Pro-Leu-Pro-Asp-Cys-Cys-Arg-Gln-Lys-Thr-Cys-Ser-Cys-Arg-Leu-Tyr-Glu-Leu-Leu-His-Gly-Ala-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Leu\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eHuman Precursor Reference:\u003c\/strong\u003e\n Corresponds to residues 34–66 of the human hypocretin neuropeptide precursor, UniProt accession O43612\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Pyroglutamate formed by cyclisation of the precursor-encoded N-terminal glutamine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal leucinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Connectivity:\u003c\/strong\u003e\n Cys\u003csup\u003e6\u003c\/sup\u003e–Cys\u003csup\u003e12\u003c\/sup\u003e and Cys\u003csup\u003e7\u003c\/sup\u003e–Cys\u003csup\u003e14\u003c\/sup\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTotal Disulphide Bonds:\u003c\/strong\u003e\n Two intramolecular disulphide bridges\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 205640-90-0\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 56842143\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e152\u003c\/sub\u003eH\u003csub\u003e243\u003c\/sub\u003eN\u003csub\u003e47\u003c\/sub\u003eO\u003csub\u003e44\u003c\/sub\u003eS\u003csub\u003e4\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 3561.1 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eApproximate Molecular Size:\u003c\/strong\u003e\n 3.56 kDa\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the mature peptide with its N-terminal pyroglutamate, C-terminal amide and two intramolecular disulphide bonds, without additional counter-ions, residual water or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net Orexin A peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion, residual-solvent and formulation results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The complete 33-residue sequence should be confirmed using the applicable synthesis, supplier and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Modification Confirmation:\u003c\/strong\u003e\n The N-terminal pyroglutamate should be supported by appropriate molecular-identity or mass-spectrometry documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Modification Confirmation:\u003c\/strong\u003e\n The C-terminal leucinamide should be distinguished from a free carboxylic acid terminal structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Connectivity Confirmation:\u003c\/strong\u003e\n Correct Cys\u003csup\u003e6\u003c\/sup\u003e–Cys\u003csup\u003e12\u003c\/sup\u003e and Cys\u003csup\u003e7\u003c\/sup\u003e–Cys\u003csup\u003e14\u003c\/sup\u003e connectivity is a distinct structural quality attribute and is not established by chromatographic purity alone\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the mature Orexin A molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied laboratory material is the uncountered peptide, an acetate form, a trifluoroacetate form or another counter-ion form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Confirmation:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect the total measured material mass and net peptide content of the supplied laboratory material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage, disulphide formation and chromatographic purification should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely modified termini, reduced peptide, incorrectly paired disulphide species and other peptide-related or process-related impurities are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, amino-acid sequence, terminal modifications, disulphide connectivity, chromatographic purity, net peptide content, water content, residual solvents, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The complete 33-residue Orexin A amino-acid sequence should be confirmed using the applicable batch and synthesis records.\n \u003cbr\u003e\n\n ✓ Terminal-modification documentation – N-terminal pyroglutamate and C-terminal amidation should be supported by appropriate molecular-identity data.\n \u003cbr\u003e\n\n ✓ Disulphide-bond documentation – Formation of the two intended intramolecular disulphide bridges should be supported by appropriate structural, production or analytical records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified Orexin A molecular structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net Orexin A peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The uncountered peptide, acetate form, trifluoroacetate form or other counter-ion form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or lipopolysaccharide result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, disulphide formation, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"orexin-a-product-overview\"\u003e\n \u003cstrong\u003eOrexin A Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eOrexin A research-grade 33-residue peptide\u003c\/strong\u003e,\n also known as Hypocretin-1, is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and reference-material comparison.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The mature Orexin A structure comprises a defined sequence of 33 amino-acid residues containing an N-terminal pyroglutamate, a C-terminal amide and two intramolecular disulphide bridges. The specified disulphide connectivity is Cys\u003csup\u003e6\u003c\/sup\u003e–Cys\u003csup\u003e12\u003c\/sup\u003e and Cys\u003csup\u003e7\u003c\/sup\u003e–Cys\u003csup\u003e14\u003c\/sup\u003e.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, amino-acid sequence, terminal modifications, chromatographic purity, net peptide content, disulphide-bond connectivity, molecular form, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 205640-90-0, molecular formula C\u003csub\u003e152\u003c\/sub\u003eH\u003csub\u003e243\u003c\/sub\u003eN\u003csub\u003e47\u003c\/sub\u003eO\u003csub\u003e44\u003c\/sub\u003eS\u003csub\u003e4\u003c\/sub\u003e and average molecular weight of approximately 3561.1 g\/mol describe the mature, uncountered Orexin A molecular structure. Where the supplied laboratory material contains acetate, trifluoroacetate or another counter-ion, the applicable batch documentation should identify its contribution to the total material mass.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net peptide content. Likewise, a bacterial endotoxin or lipopolysaccharide result does not establish sterility, correct disulphide connectivity, molecular identity, terminal-modification integrity or the absence of every peptide-related and process-related impurity.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, the Regular Orexin A specification remains highly suitable. The premium black-and-gold ULTIMATE Orexin A option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP043.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP043.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022394560850,"sku":"PEP043","price":88.85,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022394593618,"sku":"PEP043","price":205.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022394626386,"sku":"PEP043","price":382.85,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022394659154,"sku":"PEP043","price":708.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022394691922,"sku":"PEP043","price":1633.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51256850547026,"sku":"PEP043","price":851.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51256853397842,"sku":"PEP043","price":1701.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51256856445266,"sku":"PEP043","price":1588.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51256861819218,"sku":"PEP043","price":3176.85,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648336286034,"sku":"PEP043U","price":286.95,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648336318802,"sku":"PEP043U","price":534.95,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648336351570,"sku":"PEP043U","price":991.25,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648336384338,"sku":"PEP043U","price":2287.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648336417106,"sku":"PEP043U","price":1191.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648336449874,"sku":"PEP043U","price":2382.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648336515410,"sku":"PEP043U","price":2223.85,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766529675602,"sku":"PEP043U","price":4446.95,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-orexin-a-peptide-uk-pure-fine-powder.png?v=1767865900"},{"product_id":"buy-orexin-b-uk","title":"OREXIN B - Research Grade Peptide","description":"\u003ch3 id=\"orexin-b-research-grade-linear-28-residue-peptide\"\u003e\n \u003cstrong\u003e\n OREXIN B\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Linear 28-Residue Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic human Orexin B peptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined linear peptide sequence comprising 28 amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n C-terminally amidated peptide structure corresponding to human Hypocretin-2\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Cysteine-free structure containing no intramolecular disulphide bonds\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated nominal amount refers to the declared Orexin B peptide content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT OREXIN B IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 19px 21px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 8px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.4px;\n text-transform: uppercase;\n \"\u003e\n Important Chemical-Form Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n This product listing describes\n \u003cstrong\u003ehuman Orexin B with the sequence RSGPPGLQGRLQRLLQASGNHAAGILTM-NH\u003csub\u003e2\u003c\/sub\u003e\u003c\/strong\u003e.\n The molecular formula and molecular weight stated below describe the uncountered, C-terminally amidated peptide.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n Trifluoroacetate, acetate and other counter-ion forms are not exact synonyms for the uncountered peptide. Where the supplied batch contains trifluoroacetate or another counter-ion, the counter-ion identity, measured content and basis of the declared vial quantity should be stated in the applicable Certificate of Analysis.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT OREXIN B IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-orexin-b-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-orexin-b-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n OREXIN B\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE Orexin B range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished Orexin B research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, deletion-sequence, oxidation-related, synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard Orexin B peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM BATCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade Orexin B product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE Orexin B remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, amino-acid sequence, terminal amidation, chromatographic purity, peptide content, molecular form, counter-ion content, oxidation products, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or LPS testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"orexin-b-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n OREXIN B\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Technical Name:\u003c\/strong\u003e\n Human Orexin-B\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Hypocretin-2; HCRT-2; Hcrt2; human Orexin B\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic linear 28-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 28 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Peptide Sequence:\u003c\/strong\u003e\n H-Arg-Ser-Gly-Pro-Pro-Gly-Leu-Gln-Gly-Arg-Leu-Gln-Arg-Leu-Leu-Gln-Ala-Ser-Gly-Asn-His-Ala-Ala-Gly-Ile-Leu-Thr-Met-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n RSGPPGLQGRLQRLLQASGNHAAGILTM-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eHuman Precursor Reference:\u003c\/strong\u003e\n Corresponds to residues 70–97 of the human hypocretin neuropeptide precursor\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eHuman Precursor Accession:\u003c\/strong\u003e\n UniProt O43612\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free arginine amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal methioninamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Structure:\u003c\/strong\u003e\n Linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None; the human Orexin B sequence contains no cysteine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 205640-91-1\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 90479794\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e123\u003c\/sub\u003eH\u003csub\u003e212\u003c\/sub\u003eN\u003csub\u003e44\u003c\/sub\u003eO\u003csub\u003e35\u003c\/sub\u003eS\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 2899.36 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eApproximate Molecular Size:\u003c\/strong\u003e\n 2.90 kDa\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eInChIKey:\u003c\/strong\u003e\n DHBREICAXZPFDD-WMQZXSDYSA-N\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSulphur-Containing Residue:\u003c\/strong\u003e\n The single sulphur atom in the molecular formula is contributed by the C-terminal methionine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the uncountered, C-terminally amidated human Orexin B peptide without trifluoroacetate, acetate, residual water, solvents or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net Orexin B peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion, residual-solvent and formulation results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eHuman Sequence Confirmation:\u003c\/strong\u003e\n The complete human 28-residue sequence should be confirmed using the applicable supplier, synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSpecies Confirmation:\u003c\/strong\u003e\n Human Orexin B should be distinguished from rat, mouse, canine and other species variants, which may have different amino-acid sequences, molecular formulae and molecular weights\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Amidation Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the C-terminal methioninamide and distinguish it from a free carboxylic acid terminal structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the specified human Orexin B molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTFA Status:\u003c\/strong\u003e\n Trifluoroacetate is a counter-ion form rather than an exact synonym for Orexin B\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied laboratory material is the uncountered peptide, an Orexin B trifluoroacetate form, an acetate form or another counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Trifluoroacetate, acetate or another counter-ion may affect the total supplied material mass and the calculated net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as net Orexin B peptide equivalent or as total supplied salt-form material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOxidation Control:\u003c\/strong\u003e\n Oxidation of the C-terminal methionine residue is a distinct peptide-related quality attribute and should be assessed or controlled where required by the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage and chromatographic purification should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely amidated material, methionine oxidation products, incompletely deprotected sequences and other synthesis-related or process-related impurities are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, amino-acid sequence, terminal amidation, chromatographic purity, net peptide content, methionine oxidation, water content, residual solvents, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The complete human 28-residue amino-acid sequence should be confirmed using the applicable batch and synthesis records.\n \u003cbr\u003e\n\n ✓ Terminal-modification documentation – C-terminal methioninamide should be supported by appropriate molecular-identity data.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified Orexin B structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net Orexin B peptide content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The uncountered peptide, trifluoroacetate form, acetate form or other counter-ion presentation should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Oxidation-control documentation – Methionine oxidation should be assessed or controlled where required by the applicable research specification.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or lipopolysaccharide result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"orexin-b-product-overview\"\u003e\n \u003cstrong\u003eOrexin B Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eOrexin B research-grade linear peptide\u003c\/strong\u003e,\n also known as human Hypocretin-2, is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and reference-material comparison.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Mature human Orexin B comprises a defined linear sequence of 28 amino-acid residues corresponding to residues 70–97 of the human hypocretin neuropeptide precursor. It has a free N-terminal arginine and a C-terminal methioninamide. Unlike Orexin A, Orexin B contains no cysteine residues and therefore has no intramolecular disulphide bonds.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, species sequence, terminal amidation, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, methionine oxidation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 205640-91-1, molecular formula C\u003csub\u003e123\u003c\/sub\u003eH\u003csub\u003e212\u003c\/sub\u003eN\u003csub\u003e44\u003c\/sub\u003eO\u003csub\u003e35\u003c\/sub\u003eS and average molecular weight of approximately 2899.36 g\/mol describe the uncountered, C-terminally amidated human Orexin B peptide. Where the supplied laboratory material contains trifluoroacetate, acetate or another counter-ion, the applicable batch documentation should identify its contribution to the total material mass.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n “Human Orexin B TFA” describes a trifluoroacetate presentation rather than an alternative name for every Orexin B batch. The applicable product documentation should therefore distinguish the peptide identity from its counter-ion form and state whether the declared vial quantity represents net peptide equivalent or total salt-form material.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net peptide content. Likewise, a bacterial endotoxin or lipopolysaccharide result does not establish sterility, molecular identity, correct terminal amidation, species identity or the absence of every peptide-related and process-related impurity.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, the Regular Orexin B specification remains highly suitable. The premium black-and-gold ULTIMATE Orexin B option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP044.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP044.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022420447570,"sku":"PEP044","price":65.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022420480338,"sku":"PEP044","price":151.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022420513106,"sku":"PEP044","price":281.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022420545874,"sku":"PEP044","price":521.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022420578642,"sku":"PEP044","price":1201.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51256871092562,"sku":"PEP044","price":626.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51256873812306,"sku":"PEP044","price":1251.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51256876171602,"sku":"PEP044","price":1168.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51256878858578,"sku":"PEP044","price":2336.5,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648336023890,"sku":"PEP044U","price":211.85,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648336056658,"sku":"PEP044U","price":393.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648336089426,"sku":"PEP044U","price":729.85,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648336122194,"sku":"PEP044U","price":1682.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648336154962,"sku":"PEP044U","price":876.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648336187730,"sku":"PEP044U","price":1752.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648336253266,"sku":"PEP044U","price":1635.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766529577298,"sku":"PEP044U","price":3270.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-orexin-b-uk-pure-fine-peptide-powder.png?v=1767865902"},{"product_id":"purchase-pal-ghk-uk","title":"PAL-GHK - Research Grade Peptide","description":"\u003ch3 id=\"pal-ghk-research-grade-palmitoylated-tripeptide\"\u003e\n \u003cstrong\u003e\n PAL-GHK\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Palmitoylated Tripeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade Palmitoyl Tripeptide-1 laboratory material with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined Gly-His-Lys tripeptide sequence containing an N-terminal palmitoyl modification\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, lipopeptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n PAL-GHK, also known as Palmitoyl Tripeptide-1, is a synthetic lipopeptide comprising the tripeptide sequence Gly-His-Lys modified with an N-terminal palmitoyl group. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage and analytical investigation. The stated nominal amount refers to the declared PAL-GHK content of a single vial, subject to the applicable batch documentation. Where dissolution is required, the solvent, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT PAL-GHK IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 19px 21px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 8px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.4px;\n text-transform: uppercase;\n \"\u003e\n Important Molecular Identity Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n This PEP046 listing describes\n \u003cstrong\u003ePalmitoyl Tripeptide-1 with the structure Pal-Gly-His-Lys-OH\u003c\/strong\u003e.\n The palmitoyl group is covalently attached to the N-terminus of the GHK tripeptide and forms part of the defined molecular structure.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n PAL-GHK is chemically distinct from unmodified GHK and from the copper complex GHK-Cu. It does not contain copper unless a copper component is expressly declared in the applicable formulation and batch documentation. The molecular formula and molecular weight stated below describe the uncountered PAL-GHK free-acid structure without trifluoroacetate, acetate, residual water, solvents or formulation excipients.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT PAL-GHK IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-pal-ghk-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-pal-ghk-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n PAL-GHK\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Lipopeptide Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE PAL-GHK range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of lipopeptide purification and quality control. Following the standard peptide synthesis, N-terminal palmitoylation and purification workflow, the finished PAL-GHK research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual lipopeptide-related, acylation-related, deletion-sequence, synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard PAL-GHK synthesis, palmitoylation and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM BATCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional lipopeptide purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, chromatographic, formulation, lipopeptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade PAL-GHK product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of lipopeptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE PAL-GHK remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, amino-acid sequence, N-terminal palmitoylation, chromatographic purity, lipopeptide content, molecular form, counter-ion content, aggregation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"pal-ghk-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n PAL-GHK\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Palmitoyl Tripeptide-1\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Pal-GHK; Palmitoyl-GHK tripeptide; Palmitoylglycylhistidyllysine; Palmitoyl oligopeptide; N-palmitoyl-Gly-His-Lys\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic N-terminally palmitoylated tripeptide and lipopeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Sequence Length:\u003c\/strong\u003e\n Three amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCore Peptide Sequence:\u003c\/strong\u003e\n Gly-His-Lys\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Core Sequence:\u003c\/strong\u003e\n GHK\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Structural Shorthand:\u003c\/strong\u003e\n Pal-Gly-His-Lys-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Structural Shorthand:\u003c\/strong\u003e\n Pal-GHK-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSystematic Name:\u003c\/strong\u003e\n N-(1-oxohexadecyl)glycyl-L-histidyl-L-lysine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Modification:\u003c\/strong\u003e\n The N-terminal glycine is covalently acylated with a hexadecanoyl or palmitoyl group\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free L-lysine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCopper Content:\u003c\/strong\u003e\n None in the defined PAL-GHK molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None; the GHK sequence contains no cysteine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 147732-56-7\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 10231864\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n RV743D216M\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e30\u003c\/sub\u003eH\u003csub\u003e54\u003c\/sub\u003eN\u003csub\u003e6\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 578.79 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCalculated Monoisotopic Mass:\u003c\/strong\u003e\n Approximately 578.4156 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the uncountered PAL-GHK free-acid structure without trifluoroacetate, acetate, residual water, solvents, formulation excipients or other batch-dependent components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eProduct-Identity Clarification:\u003c\/strong\u003e\n PAL-GHK is the palmitoylated derivative of the GHK tripeptide and is not chemically identical to unmodified GHK\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eGHK-Cu Distinction:\u003c\/strong\u003e\n PAL-GHK is not the copper complex GHK-Cu and the defined molecular formula contains no copper atom\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMixture Distinction:\u003c\/strong\u003e\n This listing describes the single Palmitoyl Tripeptide-1 substance and should not be interpreted as an unspecified multi-ingredient lipopeptide blend\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic purity represents the relative chromatographic composition measured under the stated analytical conditions and should not automatically be interpreted as equivalent to total net PAL-GHK content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eLipopeptide-Content Specification:\u003c\/strong\u003e\n Net PAL-GHK content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion, residual-solvent and formulation results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The complete Gly-His-Lys sequence should be confirmed using the applicable supplier, synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePalmitoylation Confirmation:\u003c\/strong\u003e\n Product identity should confirm the presence and N-terminal position of the palmitoyl modification using suitable mass-spectrometry or equivalent molecular-identity data\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTerminal-Structure Confirmation:\u003c\/strong\u003e\n The applicable molecular-identity documentation should confirm the free C-terminal carboxylic acid structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the specified PAL-GHK molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied laboratory material is the uncountered free-acid lipopeptide, a trifluoroacetate form, an acetate form or another counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Trifluoroacetate, acetate or another counter-ion may affect the total supplied material mass and calculated net PAL-GHK content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as net PAL-GHK equivalent or as total supplied salt-form or formulated material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water may contribute to the total material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage, palmitoylation, chromatographic purification and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Unmodified GHK, incomplete peptide sequences, deletion sequences, incompletely palmitoylated material, free palmitic acid, acylation-related by-products and other synthesis-related or process-related impurities are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAggregation and Physical State:\u003c\/strong\u003e\n Aggregation, micelle formation and other concentration-dependent physical behaviour are separate quality attributes and are not established by a chromatographic purity percentage alone\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, co-solvent, concentration and mixing procedure should be selected using the applicable batch documentation and validated laboratory method; a universal solvent instruction should not be applied to every PAL-GHK preparation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, amino-acid sequence, N-terminal palmitoylation, terminal structure, chromatographic purity, net lipopeptide content, aggregation, water content, residual solvents, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance where available.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The complete Gly-His-Lys tripeptide sequence should be confirmed using the applicable synthesis and batch records.\n \u003cbr\u003e\n\n ✓ Palmitoylation documentation – The covalent N-terminal palmitoyl modification should be supported by appropriate molecular-identity data.\n \u003cbr\u003e\n\n ✓ Terminal-structure documentation – The free C-terminal carboxylic acid structure should be confirmed using the applicable molecular-identity records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified PAL-GHK structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Lipopeptide-content documentation – Net PAL-GHK content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The uncountered lipopeptide, trifluoroacetate form, acetate form or other counter-ion presentation should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or lipopolysaccharide result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, palmitoylation, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"pal-ghk-product-overview\"\u003e\n \u003cstrong\u003ePAL-GHK Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003ePAL-GHK research-grade palmitoylated tripeptide\u003c\/strong\u003e,\n also known as Palmitoyl Tripeptide-1, is supplied for controlled scientific laboratory investigation, analytical method development, lipopeptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows, formulation studies and reference-material comparison.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n PAL-GHK comprises the defined Gly-His-Lys tripeptide sequence containing a covalently attached N-terminal palmitoyl group and a free C-terminal carboxylic acid. The lipid modification substantially changes the physicochemical properties of the underlying GHK tripeptide and should therefore be confirmed as part of the molecular-identity assessment.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, amino-acid sequence, N-terminal palmitoylation, terminal structure, chromatographic purity, net lipopeptide content, molecular form, counter-ion content, water content, residual solvents, aggregation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 147732-56-7, molecular formula C\u003csub\u003e30\u003c\/sub\u003eH\u003csub\u003e54\u003c\/sub\u003eN\u003csub\u003e6\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e and average molecular weight of approximately 578.79 g\/mol describe the uncountered PAL-GHK free-acid molecule. Where the supplied laboratory material contains trifluoroacetate, acetate, residual water, solvents or formulation ingredients, the applicable batch documentation should identify their contribution to the total supplied material mass.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n PAL-GHK should not be confused with unmodified GHK or GHK-Cu. Unmodified GHK does not contain the palmitoyl group, while GHK-Cu is a copper coordination complex. PAL-GHK contains no copper unless a copper component is separately and expressly declared in the applicable product formulation and batch documentation.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net PAL-GHK content. Likewise, a bacterial endotoxin or lipopolysaccharide result does not establish sterility, molecular identity, correct N-terminal palmitoylation, sequence integrity or the absence of every synthesis-related and process-related impurity.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, chromatographic, formulation, lipopeptide-characterisation and general laboratory work, the Regular PAL-GHK specification remains highly suitable. The premium black-and-gold ULTIMATE PAL-GHK option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP046.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP046.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50022478283090,"sku":"PEP046","price":6.5,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50022478315858,"sku":"PEP046","price":14.25,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022478348626,"sku":"PEP046","price":26.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022478381394,"sku":"PEP046","price":47.25,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022478414162,"sku":"PEP046","price":108.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51256922145106,"sku":"PEP046","price":57.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51256923455826,"sku":"PEP046","price":113.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51256924963154,"sku":"PEP046","price":105.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51256926929234,"sku":"PEP046","price":210.95,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648335728978,"sku":"PEP046U","price":19.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648335761746,"sku":"PEP046U","price":36.25,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648335794514,"sku":"PEP046U","price":66.95,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648335827282,"sku":"PEP046U","price":152.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648335860050,"sku":"PEP046U","price":79.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648335892818,"sku":"PEP046U","price":158.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648335958354,"sku":"PEP046U","price":147.5,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766529511762,"sku":"PEP046U","price":294.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-purchase-pal-ghk-uk-pure-fine-peptide-powder.png?v=1767865900"},{"product_id":"buy-ss-31-research-peptides","title":"SS-31 - Research Grade Peptide","description":"\u003ch3 id=\"ss-31-research-grade-modified-tetrapeptide\"\u003e\n \u003cstrong\u003e\n SS-31\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, Helvetica, sans-serif;\"\u003e\n – Research-Grade Modified Tetrapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade, sequence-defined modified tetrapeptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined D-Arg-Dmt-Lys-Phe-NH\u003csub\u003e2\u003c\/sub\u003e peptide structure\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content, molecular form and counter-ion information stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n SS-31, also known as elamipretide, is a sequence-defined modified tetrapeptide comprising D-arginine, 2,6-dimethyl-L-tyrosine, L-lysine and C-terminally amidated L-phenylalanine. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage, analytical method development and peptide characterisation. The stated nominal amount refers to the declared SS-31 peptide content of a single vial, subject to the applicable batch documentation and stated assay basis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Where dissolution or reconstitution is required, the solvent, buffer, concentration, mixing procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal solvent instruction should not be applied to every SS-31 molecular form or formulation. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT SS-31 CHEMICAL-FORM NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 19px 21px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 8px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.4px;\n text-transform: uppercase;\n \"\u003e\n Important Chemical-Form Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n This PEP052 product page describes the parent SS-31 or elamipretide peptide with the structure\n \u003cstrong\u003e\n H-D-Arg-2,6-dimethyl-L-Tyr-L-Lys-L-Phe-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/strong\u003e,\n CAS number 736992-21-5 and molecular formula\n C\u003csub\u003e32\u003c\/sub\u003eH\u003csub\u003e49\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n Elamipretide hydrochloride is a distinct trihydrochloride salt with a 1:3 peptide-to-hydrochloride relationship, CAS number 2244098-12-0, formula\n C\u003csub\u003e32\u003c\/sub\u003eH\u003csub\u003e49\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e·3HCl\n and molecular weight approximately 749.2 g\/mol.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n The applicable batch Certificate of Analysis must identify whether the supplied material is the parent peptide, elamipretide trihydrochloride, an acetate-containing form, a trifluoroacetate-containing form or another counter-ion presentation. These chemical forms should not be assigned the same CAS number, molecular formula or formula weight without qualification.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT SS-31 CHEMICAL-FORM NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-ss-31-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-ss-31-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n SS-31\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Additional High-Performance Liquid Chromatography Purification and More Stringent Lipopolysaccharide Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n A premium research specification incorporating an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding analytical and laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE SS-31 range\n \u003c\/strong\u003e\n is our premium laboratory specification for research projects requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished SS-31 research material undergoes an additional preparative high-performance liquid chromatography purification stage. This supplementary chromatographic process is intended to reduce residual peptide-related, deletion-sequence, synthesis-related and process-related impurities further.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification. The applicable test method, reporting units, acceptance criterion and batch result should be stated in the corresponding Certificate of Analysis where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL CHROMATOGRAPHIC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional Chromatographic Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard SS-31 peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent Endotoxin Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM BATCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade SS-31 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE SS-31 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Molecular identity, amino-acid sequence, stereochemistry, terminal amidation, chromatographic purity, peptide content, molecular form, counter-ion content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"ss-31-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n SS-31\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Elamipretide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Designations:\u003c\/strong\u003e\n SS31; MTP-131; MTP131; RX-31; Bendavia; Szeto-Schiller peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic sequence-defined modified tetrapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Four amino-acid and modified amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Peptide Sequence:\u003c\/strong\u003e\n H-D-Arg-2,6-dimethyl-L-Tyr-L-Lys-L-Phe-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStructural Shorthand:\u003c\/strong\u003e\n H-D-Arg-Dmt-Lys-Phe-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDmt Residue:\u003c\/strong\u003e\n Dmt denotes 2,6-dimethyl-L-tyrosine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence-Based Chemical Name:\u003c\/strong\u003e\n D-arginyl-2,6-dimethyl-L-tyrosyl-L-lysyl-L-phenylalaninamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStereochemical Configuration:\u003c\/strong\u003e\n All amino-acid residues have the L configuration except for the N-terminal arginine, which has the D configuration\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free D-arginine amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal L-phenylalaninamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Structure:\u003c\/strong\u003e\n Linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None; the SS-31 sequence contains no cysteine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Elamipretide CAS Number:\u003c\/strong\u003e\n 736992-21-5\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Elamipretide PubChem Compound Identifier:\u003c\/strong\u003e\n CID 11764719\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Elamipretide Unique Ingredient Identifier:\u003c\/strong\u003e\n 87GWG91S09\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Elamipretide Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e32\u003c\/sub\u003eH\u003csub\u003e49\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Elamipretide Average Molecular Weight:\u003c\/strong\u003e\n Approximately 639.80 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Elamipretide InChIKey:\u003c\/strong\u003e\n SFVLTCAESLKEHH-WKAQUBQDSA-N\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent-Formula Basis:\u003c\/strong\u003e\n The formula C\u003csub\u003e32\u003c\/sub\u003eH\u003csub\u003e49\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e and molecular weight of approximately 639.80 g\/mol describe the parent elamipretide molecular structure without additional hydrochloride, acetate, trifluoroacetate, residual water, solvents or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eElamipretide Hydrochloride CAS Number:\u003c\/strong\u003e\n 2244098-12-0\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eElamipretide Hydrochloride Unique Ingredient Identifier:\u003c\/strong\u003e\n E40WZ3BK2D\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eElamipretide Hydrochloride Salt Form:\u003c\/strong\u003e\n Elamipretide trihydrochloride, with a peptide-to-hydrochloride relationship of 1:3\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eElamipretide Hydrochloride Formula:\u003c\/strong\u003e\n C\u003csub\u003e32\u003c\/sub\u003eH\u003csub\u003e49\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e·3HCl\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eExpanded Elamipretide Hydrochloride Formula:\u003c\/strong\u003e\n C\u003csub\u003e32\u003c\/sub\u003eH\u003csub\u003e52\u003c\/sub\u003eCl\u003csub\u003e3\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eElamipretide Hydrochloride Average Molecular Weight:\u003c\/strong\u003e\n Approximately 749.2 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is parent elamipretide, elamipretide trihydrochloride, an acetate-containing form, a trifluoroacetate-containing form or another counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number Selection:\u003c\/strong\u003e\n CAS number 736992-21-5 should be used for the parent elamipretide identity, while CAS number 2244098-12-0 applies to the defined elamipretide trihydrochloride\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular-Weight Selection:\u003c\/strong\u003e\n The molecular weight displayed on the product page, Certificate of Analysis and Safety Data Sheet must correspond to the actual molecular or salt form supplied\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as parent SS-31 peptide equivalent, total hydrochloride salt material, another counter-ion form or total formulated lyophilised material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic purity represents the relative chromatographic composition measured under the stated analytical conditions and should not automatically be interpreted as equivalent to total net SS-31 peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net SS-31 peptide content should be distinguished from chromatographic purity and interpreted alongside counter-ion content, water content, residual solvents and formulation components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The complete D-Arg-Dmt-Lys-Phe-NH\u003csub\u003e2\u003c\/sub\u003e sequence should be confirmed using the applicable supplier, synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStereochemical Confirmation:\u003c\/strong\u003e\n The D-arginine configuration and L configuration of the remaining chiral residues should be supported by appropriate synthesis records or stereochemical analytical documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eModified-Residue Confirmation:\u003c\/strong\u003e\n Molecular-identity records should confirm the presence of the 2,6-dimethyl-L-tyrosine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Amidation Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the C-terminal phenylalaninamide and distinguish it from a free carboxylic acid terminal structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the exact SS-31 molecular or salt form stated for the applicable batch\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Hydrochloride, acetate, trifluoroacetate or another counter-ion may affect the total supplied material mass, formula weight and calculated net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water and hydration state may contribute to the total material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage, purification, salt conversion, concentration and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely deprotected material, stereochemical impurities, modified-residue impurities and other synthesis-related or process-related substances are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, buffer, concentration and mixing procedure should be selected using the applicable batch documentation and validated laboratory method; a universal bacteriostatic-water instruction should not be applied to every SS-31 chemical form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, amino-acid sequence, stereochemistry, terminal amidation, chromatographic purity, net peptide content, salt form, counter-ion content, water content, residual solvents and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The complete D-Arg-Dmt-Lys-Phe-NH\u003csub\u003e2\u003c\/sub\u003e sequence should be confirmed using the applicable synthesis and batch records.\n \u003cbr\u003e\n\n ✓ Stereochemical documentation – The D-arginine residue and remaining L-configured residues should be supported by appropriate synthesis or analytical documentation.\n \u003cbr\u003e\n\n ✓ Modified-residue documentation – The 2,6-dimethyl-L-tyrosine residue should be confirmed using suitable molecular-identity records.\n \u003cbr\u003e\n\n ✓ Terminal-modification documentation – C-terminal phenylalaninamide should be confirmed and distinguished from a free carboxylic acid terminal structure.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified SS-31 molecular or salt form.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net SS-31 peptide content should be distinguished from chromatographic purity and interpreted alongside counter-ion, water and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – Parent elamipretide, trihydrochloride, acetate-containing, trifluoroacetate-containing or another counter-ion form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or lipopolysaccharide result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification, salt-form and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"ss-31-product-overview\"\u003e\n \u003cstrong\u003eSS-31 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eSS-31 research-grade modified tetrapeptide\u003c\/strong\u003e,\n also known as elamipretide or MTP-131, is supplied for controlled scientific laboratory investigation, analytical method development, modified peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and reference-material comparison.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n SS-31 comprises a defined four-residue structure containing N-terminal D-arginine, 2,6-dimethyl-L-tyrosine, L-lysine and C-terminally amidated L-phenylalanine. The modified tyrosine residue, D-arginine stereochemistry and terminal phenylalaninamide form part of the molecular identity and should be confirmed through the applicable synthesis records and analytical documentation.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, amino-acid sequence, stereochemical configuration, modified-residue identity, terminal amidation, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 736992-21-5, molecular formula C\u003csub\u003e32\u003c\/sub\u003eH\u003csub\u003e49\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e and average molecular weight of approximately 639.80 g\/mol describe the parent elamipretide peptide. Elamipretide trihydrochloride is a separate salt form with CAS number 2244098-12-0, formula C\u003csub\u003e32\u003c\/sub\u003eH\u003csub\u003e49\u003c\/sub\u003eN\u003csub\u003e9\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e·3HCl and molecular weight approximately 749.2 g\/mol.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Where the supplied laboratory material contains hydrochloride, acetate, trifluoroacetate, residual water, solvents or formulation ingredients, the applicable batch documentation should identify their contribution to the total supplied material mass. The product specification should also state whether the nominal vial quantity represents parent SS-31 peptide equivalent or total supplied salt-form material.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net SS-31 peptide content. Likewise, a bacterial endotoxin or lipopolysaccharide result does not establish sterility, molecular identity, correct stereochemistry, modified-residue identity, terminal amidation or the absence of every peptide-related and process-related impurity.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, the Regular SS-31 specification remains highly suitable. The premium black-and-gold ULTIMATE SS-31 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP052.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP052.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"5mg","offer_id":50022586614098,"sku":"PEP052","price":32.25,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022586646866,"sku":"PEP052","price":60.25,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022586679634,"sku":"PEP052","price":111.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022586712402,"sku":"PEP052","price":255.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51257615450450,"sku":"PEP052","price":133.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51257618399570,"sku":"PEP052","price":266.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51257619546450,"sku":"PEP052","price":248.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51257623150930,"sku":"PEP052","price":496.5,"currency_code":"GBP","in_stock":true},{"title":"5mg Ultimate","offer_id":54671474491730,"sku":"PEP052U","price":49.5,"currency_code":"GBP","in_stock":true},{"title":"10mg Ultimate","offer_id":54671481274706,"sku":"PEP052U","price":78.85,"currency_code":"GBP","in_stock":true},{"title":"20mg Ultimate","offer_id":54671487041874,"sku":"PEP052U","price":150.85,"currency_code":"GBP","in_stock":true},{"title":"50mg Ultimate","offer_id":54671492645202,"sku":"PEP052U","price":350.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54766529315154,"sku":"PEP052U","price":193.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54766529347922,"sku":"PEP052U","price":385.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54766529380690,"sku":"PEP052U","price":360.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766529413458,"sku":"PEP052U","price":719.85,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-ss-31-research-peptides-pure-fine-powder.png?v=1767887109"},{"product_id":"tb-500-peptide-uk-research-grade","title":"TB-500 (Thymosin Beta-4) - Research Grade Peptide","description":"\u003ch3 id=\"tb-500-thymosin-beta-4-research-grade-full-length-peptide\"\u003e\n \u003cstrong\u003e\n TB 500 (Thymosin Beta-4)\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, Helvetica, sans-serif;\"\u003e\n – Research-Grade Full-Length 43-Residue Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade full-length thymosin beta-4 peptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined 43-residue timbetasin structure with covalent N-terminal acetylation\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Full-length molecular identity corresponding to CAS number 77591-33-4\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content, molecular form and counter-ion information stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n This PEP053 product is intended to represent full-length thymosin beta-4, also known by the recognised substance name timbetasin. The defined molecule is a linear 43-residue peptide containing covalent N-terminal acetylation and a free C-terminal carboxylic acid. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage, analytical method development and peptide characterisation. The stated nominal amount refers to the declared full-length thymosin beta-4 peptide content of a single vial, subject to the applicable batch documentation and stated assay basis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Where dissolution or reconstitution is required, the solvent, buffer, concentration, mixing procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal solvent instruction should not be applied to every chemical form, counter-ion presentation or formulated preparation. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT TB 500 IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 19px 21px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 8px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.4px;\n text-transform: uppercase;\n \"\u003e\n Important Molecular Identity Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n This PEP053 listing describes\n \u003cstrong\u003e\n full-length N-terminally acetylated thymosin beta-4 or timbetasin\n \u003c\/strong\u003e,\n comprising 43 amino-acid residues. Its reference molecular formula is\n C\u003csub\u003e212\u003c\/sub\u003eH\u003csub\u003e350\u003c\/sub\u003eN\u003csub\u003e56\u003c\/sub\u003eO\u003csub\u003e78\u003c\/sub\u003eS,\n and its average molecular weight is approximately 4,963 g\/mol.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n The term TB-500 is also used in analytical and substance-registry records for the separate seven-residue fragment\n \u003cstrong\u003eAc-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH\u003c\/strong\u003e,\n abbreviated Ac-LKKTETQ-OH. That fragment is not chemically identical to the full-length 43-residue thymosin beta-4 molecule described on this page.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n The applicable PEP053 Certificate of Analysis should confirm the complete 43-residue sequence, N-terminal acetylation, measured molecular mass and CAS number 77591-33-4. Where testing instead identifies the shorter Ac-LKKTETQ fragment, the product must be assigned separate chemical identifiers, analytical specifications and supporting documentation.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT TB 500 IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-tb-500-thymosin-beta-4-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-tb-500-thymosin-beta-4-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n TB 500\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Full-Length Thymosin Beta-4 with Additional High-Performance Liquid Chromatography Purification\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE TB 500 full-length thymosin beta-4 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished 43-residue thymosin beta-4 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual full-length peptide-related, deletion-sequence, truncation, oxidation-related, synthesis-related and process-related impurities further.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification. The applicable test method, reporting units, acceptance criterion and batch result should be stated in the corresponding Certificate of Analysis where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL CHROMATOGRAPHIC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard full-length thymosin beta-4 purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM IDENTITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Full-Length Identity Control\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring the complete 43-residue thymosin beta-4 sequence rather than a shorter thymosin-derived fragment.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade full-length Thymosin Beta-4 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE TB 500 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Molecular identity, full-length amino-acid sequence, N-terminal acetylation, chromatographic purity, peptide content, molecular form, counter-ion content, methionine oxidation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"tb-500-thymosin-beta-4-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eCatalogue Product Name:\u003c\/strong\u003e\n TB 500 (Thymosin Beta-4)\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDefined PEP053 Identity:\u003c\/strong\u003e\n Full-length N-terminally acetylated thymosin beta-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRecognised Substance Name:\u003c\/strong\u003e\n Timbetasin\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Thymosin beta-4; Thymosin β4; Tβ4; Tβ4; beta-thymosin 4; Fx peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNaming Clarification:\u003c\/strong\u003e\n The commercial designation TB 500 is used inconsistently and may refer either to full-length thymosin beta-4 or to the separate N-acetylated 17–23 fragment. This PEP053 listing specifically describes the full-length 43-residue molecule.\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic N-terminally acetylated linear 43-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 43 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Modified Peptide Sequence:\u003c\/strong\u003e\n Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eModified One-Letter Sequence:\u003c\/strong\u003e\n Ac-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Covalently N-acetylated serine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free serine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Structure:\u003c\/strong\u003e\n Linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None; the thymosin beta-4 sequence contains no cysteine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMethionine Content:\u003c\/strong\u003e\n One methionine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSulphur Content:\u003c\/strong\u003e\n The single sulphur atom in the molecular formula is contributed by the methionine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Timbetasin CAS Number:\u003c\/strong\u003e\n 77591-33-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 16132341\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n 2D5MRE3SSY\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e212\u003c\/sub\u003eH\u003csub\u003e350\u003c\/sub\u003eN\u003csub\u003e56\u003c\/sub\u003eO\u003csub\u003e78\u003c\/sub\u003eS\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 4,963 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eApproximate Molecular Size:\u003c\/strong\u003e\n 4.96 kDa\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCalculated Monoisotopic Mass:\u003c\/strong\u003e\n Approximately 4960.4863 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the full-length, N-terminally acetylated timbetasin molecule without additional acetate, trifluoroacetate, residual water, solvents or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTimbetasin Acetate CAS Number:\u003c\/strong\u003e\n 1346423-89-9\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTimbetasin Acetate Unique Ingredient Identifier:\u003c\/strong\u003e\n 945CRJ0XZ0\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTimbetasin Acetate General Formula:\u003c\/strong\u003e\n C\u003csub\u003e212\u003c\/sub\u003eH\u003csub\u003e350\u003c\/sub\u003eN\u003csub\u003e56\u003c\/sub\u003eO\u003csub\u003e78\u003c\/sub\u003eS\n ·\n xC\u003csub\u003e2\u003c\/sub\u003eH\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTimbetasin Acetate Molecular Weight:\u003c\/strong\u003e\n Dependent upon the measured acetate stoichiometry; refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Identity:\u003c\/strong\u003e\n N-acetylated thymosin beta-4 residues 17–23\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Sequence:\u003c\/strong\u003e\n Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Shorthand:\u003c\/strong\u003e\n Ac-LKKTETQ-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment CAS Number:\u003c\/strong\u003e\n 885340-08-9\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment PubChem Compound Identifier:\u003c\/strong\u003e\n CID 62707662\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Unique Ingredient Identifier:\u003c\/strong\u003e\n QHK6Z47GTG\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e38\u003c\/sub\u003eH\u003csub\u003e68\u003c\/sub\u003eN\u003csub\u003e10\u003c\/sub\u003eO\u003csub\u003e14\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Average Molecular Weight:\u003c\/strong\u003e\n Approximately 889.0 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFragment Distinction:\u003c\/strong\u003e\n The seven-residue Ac-LKKTETQ fragment and the full-length 43-residue thymosin beta-4 molecule are separate chemical substances and should not share a Certificate of Analysis, molecular formula, molecular weight or mass-spectrometry acceptance criterion\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic purity represents the relative chromatographic composition measured under the stated analytical conditions and does not by itself establish full-length molecular identity or total net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net full-length thymosin beta-4 content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion, residual-solvent and formulation results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as net timbetasin peptide equivalent or as total supplied salt-form or formulated material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFull-Length Sequence Confirmation:\u003c\/strong\u003e\n The complete 43-residue sequence should be confirmed using the applicable supplier, synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Acetylation Confirmation:\u003c\/strong\u003e\n Product identity should confirm the covalent N-terminal acetyl group using suitable mass-spectrometry or equivalent molecular-identity data\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the free C-terminal serine carboxylic acid structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the complete full-length timbetasin molecule rather than the separate seven-residue TB-500 fragment\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is parent timbetasin, timbetasin acetate, a trifluoroacetate-containing form or another counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect the total supplied material mass and calculated net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water may contribute to the total material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage, purification, concentration and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMethionine-Oxidation Control:\u003c\/strong\u003e\n Oxidation of the single methionine residue is a distinct peptide-related quality attribute and should be assessed or controlled where required by the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely acetylated material, methionine oxidation products, incompletely deprotected sequences and other synthesis-related or process-related substances are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, buffer, concentration and mixing procedure should be selected using the applicable batch documentation and validated laboratory method; a universal bacteriostatic-water instruction should not be applied to every thymosin beta-4 chemical form or formulation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, full-length amino-acid sequence, N-terminal acetylation, terminal structure, chromatographic purity, net peptide content, methionine oxidation, water content, residual solvents, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Full-length sequence documentation – The complete 43-residue thymosin beta-4 sequence should be confirmed using the applicable synthesis and batch records.\n \u003cbr\u003e\n\n ✓ N-terminal modification documentation – Covalent N-terminal acetylation should be supported by appropriate molecular-identity data.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the full-length approximately 4.96 kDa timbetasin molecule.\n \u003cbr\u003e\n\n ✓ Fragment distinction – The analytical documentation should distinguish full-length thymosin beta-4 from the separate seven-residue Ac-LKKTETQ TB-500 fragment.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net full-length thymosin beta-4 content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – Parent timbetasin, timbetasin acetate, trifluoroacetate-containing material or another counter-ion presentation should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Oxidation-control documentation – Methionine oxidation should be assessed or controlled where required by the applicable research specification.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or lipopolysaccharide result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"tb-500-thymosin-beta-4-product-overview\"\u003e\n \u003cstrong\u003eTB 500 (Thymosin Beta-4) Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eTB 500 full-length Thymosin Beta-4 research-grade peptide\u003c\/strong\u003e,\n also identified by the recognised substance name timbetasin, is supplied for controlled scientific laboratory investigation, analytical method development, full-length peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and reference-material comparison.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The PEP053 molecular identity comprises a defined linear sequence of 43 amino-acid residues with covalent N-terminal acetylation and a free C-terminal serine carboxylic acid. The molecule contains no cysteine residues and therefore has no intramolecular disulphide bonds. Its single sulphur atom is contributed by the methionine residue within the sequence.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 77591-33-4, molecular formula C\u003csub\u003e212\u003c\/sub\u003eH\u003csub\u003e350\u003c\/sub\u003eN\u003csub\u003e56\u003c\/sub\u003eO\u003csub\u003e78\u003c\/sub\u003eS and average molecular weight of approximately 4,963 g\/mol describe the full-length, N-terminally acetylated timbetasin molecule. Where the supplied material contains acetate, trifluoroacetate, residual water, solvents or formulation ingredients, the applicable batch documentation should identify their contribution to the total supplied material mass.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Full-length thymosin beta-4 should not be confused with the separate seven-residue material also recorded under the TB-500 name. That fragment has the sequence Ac-LKKTETQ-OH and a molecular weight of approximately 889.0 g\/mol. High-performance liquid chromatography purity alone cannot distinguish these two substances; the product name, complete sequence and mass-spectrometry result must agree.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, full-length amino-acid sequence, N-terminal acetylation, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, methionine oxidation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net peptide content or proof of the complete 43-residue sequence. Likewise, a bacterial endotoxin or lipopolysaccharide result does not establish sterility, full-length molecular identity, correct N-terminal acetylation or the absence of every peptide-related and process-related impurity.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, the Regular TB 500 full-length Thymosin Beta-4 specification remains highly suitable. The premium black-and-gold ULTIMATE TB 500 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP053.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP053.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"5mg","offer_id":50022597558610,"sku":"PEP053","price":40.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022597591378,"sku":"PEP053","price":75.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022597624146,"sku":"PEP053","price":140.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022597656914,"sku":"PEP053","price":325.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51257635406162,"sku":"PEP053","price":167.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51257637077330,"sku":"PEP053","price":333.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51257638912338,"sku":"PEP053","price":313.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51257642778962,"sku":"PEP053","price":625.95,"currency_code":"GBP","in_stock":true},{"title":"5mg Ultimate","offer_id":54671382151506,"sku":"PEP053U","price":59.25,"currency_code":"GBP","in_stock":true},{"title":"10mg Ultimate","offer_id":54671397781842,"sku":"PEP053U","price":95.5,"currency_code":"GBP","in_stock":true},{"title":"20mg Ultimate","offer_id":54671407087954,"sku":"PEP053U","price":189.95,"currency_code":"GBP","in_stock":true},{"title":"50mg Ultimate","offer_id":54671415935314,"sku":"PEP053U","price":467.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54766529118546,"sku":"PEP053U","price":242.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54766529151314,"sku":"PEP053U","price":483.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54766529184082,"sku":"PEP053U","price":453.5,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766529216850,"sku":"PEP053U","price":906.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-tb-500-peptide-uk-ultra-pure-research-powder.png?v=1767865901"},{"product_id":"thymosin-alpha-1-peptide-uk","title":"THYMOSIN ALPHA-1 - Research Grade Peptide","description":"\u003ch3 id=\"thymosin-alpha-1-research-grade-28-residue-peptide\"\u003e\n \u003cstrong\u003e\n THYMOSIN ALPHA-1\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, Helvetica, sans-serif;\"\u003e\n – Research-Grade N-Terminally Acetylated 28-Residue Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade, sequence-defined Thymosin Alpha-1 peptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined linear structure comprising 28 amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Covalently N-terminally acetylated peptide with a free C-terminal carboxylic acid\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content, molecular form and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Thymosin Alpha-1, also known by the recognised substance name thymalfasin, is a sequence-defined 28-residue peptide containing a covalent N-terminal acetyl modification. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage, analytical method development and peptide characterisation. The stated nominal amount refers to the declared Thymosin Alpha-1 peptide content of a single vial, subject to the applicable batch documentation and stated assay basis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Where dissolution or reconstitution is required, the solvent, buffer, concentration, mixing procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal solvent instruction should not be applied to every molecular form, counter-ion presentation or formulated preparation. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT THYMOSIN ALPHA-1 CHEMICAL-FORM NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 19px 21px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 8px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.4px;\n text-transform: uppercase;\n \"\u003e\n Important Molecular and Chemical-Form Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n This PEP055 listing describes the parent Thymosin Alpha-1 or thymalfasin peptide with the complete structure\n \u003cstrong\u003e\n Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH\n \u003c\/strong\u003e.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n The N-terminal acetyl group is covalently incorporated into the peptide structure. It is not an acetate counter-ion and does not, by itself, mean that the material is supplied as Thymosin Alpha-1 acetate.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n Where the supplied batch contains acetate, trifluoroacetate, sodium, ammonium or another counter-ion, its identity, measured content and contribution to the total supplied material mass should be stated separately in the applicable batch Certificate of Analysis.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT THYMOSIN ALPHA-1 CHEMICAL-FORM NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-thymosin-alpha-1-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-thymosin-alpha-1-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n THYMOSIN ALPHA-1\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Additional High-Performance Liquid Chromatography Purification and More Stringent Lipopolysaccharide Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n A premium research specification incorporating an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE Thymosin Alpha-1 range\n \u003c\/strong\u003e\n is our premium laboratory specification for scientific projects requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished Thymosin Alpha-1 research material undergoes an additional preparative high-performance liquid chromatography purification stage. This supplementary chromatographic process is designed to reduce residual peptide-related, deletion-sequence, acetylation-related, synthesis-related and process-related impurities further.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification. The applicable test method, reporting units, acceptance criterion and batch result should be stated in the corresponding Certificate of Analysis where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard Thymosin Alpha-1 peptide purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM BATCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade Thymosin Alpha-1 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE Thymosin Alpha-1 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Molecular identity, amino-acid sequence, N-terminal acetylation, chromatographic purity, peptide content, molecular form, counter-ion content, aggregation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"thymosin-alpha-1-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n THYMOSIN ALPHA-1\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Thymalfasin\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Thymosin Alpha-1; Thymosin α1; Tα1; Ta1; alpha-1 thymosin\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic N-terminally acetylated linear 28-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 28 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Modified Peptide Sequence:\u003c\/strong\u003e\n Ac-Ser-Asp-Ala-Ala-Val-Asp-Thr-Ser-Ser-Glu-Ile-Thr-Thr-Lys-Asp-Leu-Lys-Glu-Lys-Lys-Glu-Val-Val-Glu-Glu-Ala-Glu-Asn-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eModified One-Letter Sequence:\u003c\/strong\u003e\n Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Covalently N-acetylated serine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free asparagine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAcetylation Clarification:\u003c\/strong\u003e\n The N-terminal acetyl group forms part of the covalent peptide structure and is not an acetate counter-ion\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Structure:\u003c\/strong\u003e\n Linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None; the Thymosin Alpha-1 sequence contains no cysteine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSulphur Content:\u003c\/strong\u003e\n None; the sequence contains neither cysteine nor methionine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Thymalfasin CAS Number:\u003c\/strong\u003e\n 62304-98-7\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 16130571\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n W0B22ISQ1C\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e129\u003c\/sub\u003eH\u003csub\u003e215\u003c\/sub\u003eN\u003csub\u003e33\u003c\/sub\u003eO\u003csub\u003e55\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Average Molecular Weight:\u003c\/strong\u003e\n Approximately 3108.3 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eApproximate Molecular Size:\u003c\/strong\u003e\n 3.11 kDa\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the parent N-terminally acetylated Thymosin Alpha-1 peptide without additional acetate, trifluoroacetate, sodium, residual water, solvents or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Thymosin Alpha-1 Acetate Formula:\u003c\/strong\u003e\n C\u003csub\u003e129\u003c\/sub\u003eH\u003csub\u003e215\u003c\/sub\u003eN\u003csub\u003e33\u003c\/sub\u003eO\u003csub\u003e55\u003c\/sub\u003e\n ·\n xCH\u003csub\u003e3\u003c\/sub\u003eCOOH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eThymosin Alpha-1 Acetate Molecular Weight:\u003c\/strong\u003e\n Dependent upon the measured acetate stoichiometry and other batch-specific components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAcetate-Form Distinction:\u003c\/strong\u003e\n Thymosin Alpha-1 acetate is a supplied counter-ion form and should not be confused with the peptide’s covalent N-terminal acetyl modification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number Qualification:\u003c\/strong\u003e\n CAS number 62304-98-7 identifies the parent thymalfasin molecular form; where suppliers apply this CAS number to an acetate-containing material, the acetate content should still be declared separately\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic purity represents the relative chromatographic composition measured under the stated analytical conditions and should not automatically be interpreted as equivalent to total net Thymosin Alpha-1 peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net Thymosin Alpha-1 content should be distinguished from chromatographic purity and interpreted alongside counter-ion content, water content, residual solvents and formulation components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as parent thymalfasin peptide equivalent, total acetate-form material or total formulated lyophilised material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The complete 28-residue amino-acid sequence should be confirmed using the applicable supplier, synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Acetylation Confirmation:\u003c\/strong\u003e\n Product identity should confirm the presence and position of the covalent N-terminal acetyl group using suitable mass-spectrometry or equivalent molecular-identity data\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the free C-terminal asparagine carboxylic acid structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the specified approximately 3108.3 Da parent Thymosin Alpha-1 structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is parent thymalfasin, Thymosin Alpha-1 acetate, a trifluoroacetate-containing form or another counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Acetate, trifluoroacetate, sodium, ammonium or another counter-ion may affect the total supplied material mass and calculated net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAcetate-Content Specification:\u003c\/strong\u003e\n Where acetate is present, its measured content and peptide-to-acetate relationship should be stated or supported by the applicable batch analytical documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water may contribute to the total material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage, purification, concentration and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAggregation Control:\u003c\/strong\u003e\n Aggregation and other concentration-dependent physical changes are separate quality attributes and are not established by a chromatographic purity percentage alone\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely acetylated material, incompletely deprotected sequences and other synthesis-related or process-related substances are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, buffer, concentration and mixing procedure should be selected using the applicable batch documentation and validated laboratory method; a universal bacteriostatic-water instruction should not be applied to every Thymosin Alpha-1 chemical form or preparation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, amino-acid sequence, N-terminal acetylation, terminal structure, chromatographic purity, net peptide content, aggregation, water content, residual solvents, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The complete 28-residue amino-acid sequence should be confirmed using the applicable synthesis and batch records.\n \u003cbr\u003e\n\n ✓ N-terminal modification documentation – Covalent N-terminal acetylation should be supported by appropriate molecular-identity data.\n \u003cbr\u003e\n\n ✓ C-terminal structure documentation – The free C-terminal carboxylic acid structure should be confirmed using the applicable molecular-identity records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified Thymosin Alpha-1 structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net Thymosin Alpha-1 content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – Parent thymalfasin, acetate-containing, trifluoroacetate-containing or another counter-ion form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Acetate-content documentation – Acetate identity, measured content and peptide-to-acetate relationship should be stated or supported where applicable.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or lipopolysaccharide result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"thymosin-alpha-1-product-overview\"\u003e\n \u003cstrong\u003eThymosin Alpha-1 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eThymosin Alpha-1 research-grade 28-residue peptide\u003c\/strong\u003e,\n also known by the recognised substance name thymalfasin, is supplied for controlled scientific laboratory investigation, analytical method development, peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and reference-material comparison.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Thymosin Alpha-1 comprises a defined linear sequence of 28 amino-acid residues with a covalently acetylated N-terminal serine and a free C-terminal asparagine carboxylic acid. The sequence contains no cysteine residues and therefore has no intramolecular disulphide bonds.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 62304-98-7, molecular formula C\u003csub\u003e129\u003c\/sub\u003eH\u003csub\u003e215\u003c\/sub\u003eN\u003csub\u003e33\u003c\/sub\u003eO\u003csub\u003e55\u003c\/sub\u003e and average molecular weight of approximately 3108.3 g\/mol describe the parent thymalfasin peptide. Where the supplied laboratory material contains acetate, trifluoroacetate, sodium, residual water, solvents or formulation ingredients, the applicable batch documentation should identify their contribution to the total supplied material mass.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, amino-acid sequence, N-terminal acetylation, terminal structure, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, aggregation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The covalent N-terminal acetyl group should not be confused with acetate acting as a counter-ion. Where the product is supplied as Thymosin Alpha-1 acetate, the applicable product specification should state the measured acetate content and whether the nominal vial quantity represents parent thymalfasin peptide equivalent or total acetate-form material.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net peptide content. Likewise, a bacterial endotoxin or lipopolysaccharide result does not establish sterility, molecular identity, correct N-terminal acetylation, sequence integrity or the absence of every peptide-related and process-related impurity.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, the Regular Thymosin Alpha-1 specification remains highly suitable. The premium black-and-gold ULTIMATE Thymosin Alpha-1 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP055.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP055.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"5mg","offer_id":50022621610322,"sku":"PEP055","price":27.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022621643090,"sku":"PEP055","price":50.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022621675858,"sku":"PEP055","price":92.5,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022621708626,"sku":"PEP055","price":213.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51257684558162,"sku":"PEP055","price":111.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51257692356946,"sku":"PEP055","price":221.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51257693241682,"sku":"PEP055","price":207.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51257693798738,"sku":"PEP055","price":413.95,"currency_code":"GBP","in_stock":true},{"title":"5mg Ultimate","offer_id":54671152087378,"sku":"PEP055U","price":35.95,"currency_code":"GBP","in_stock":true},{"title":"10mg Ultimate","offer_id":54671161327954,"sku":"PEP055U","price":65.5,"currency_code":"GBP","in_stock":true},{"title":"20mg Ultimate","offer_id":54671170208082,"sku":"PEP055U","price":140.25,"currency_code":"GBP","in_stock":true},{"title":"50mg Ultimate","offer_id":54671178400082,"sku":"PEP055U","price":290.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-thymosin-alpha-1-peptide-uk-pure-fine-powder.png?v=1767865899"},{"product_id":"thymosin-beta-4-peptide-uk","title":"THYMOSIN BETA 4 TB500 - Research Grade Peptide","description":"\u003ch3 id=\"thymosin-beta-4-tb500-full-length-research-grade-peptide\"\u003e\n \u003cstrong\u003e\n THYMOSIN BETA-4 TB500 (FULL-LENGTH)\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, Helvetica, sans-serif;\"\u003e\n – Research-Grade 43-Residue Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade full-length thymosin beta-4 peptide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined 43-residue timbetasin structure containing covalent N-terminal acetylation\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Full-length molecular identity corresponding to CAS number 77591-33-4\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content, molecular form and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n This PEP056 product is intended to represent full-length thymosin beta-4, also known by the recognised substance name timbetasin. The defined molecule is a linear 43-residue peptide containing covalent N-terminal acetylation and a free C-terminal carboxylic acid. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage, analytical method development and peptide characterisation. The stated nominal amount refers to the declared full-length thymosin beta-4 peptide content of a single vial, subject to the applicable batch documentation and stated assay basis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Where dissolution or reconstitution is required, the solvent, buffer, concentration, mixing procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal solvent instruction should not be applied to every chemical form, counter-ion presentation or formulated preparation. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT THYMOSIN BETA-4 IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 19px 21px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 8px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.4px;\n text-transform: uppercase;\n \"\u003e\n Important Full-Length Molecular Identity Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n This PEP056 listing specifically describes\n \u003cstrong\u003e\n full-length N-terminally acetylated thymosin beta-4 or timbetasin\n \u003c\/strong\u003e,\n comprising 43 amino-acid residues. Its molecular formula is\n C\u003csub\u003e212\u003c\/sub\u003eH\u003csub\u003e350\u003c\/sub\u003eN\u003csub\u003e56\u003c\/sub\u003eO\u003csub\u003e78\u003c\/sub\u003eS,\n and its average molecular weight is approximately 4,963.5 g\/mol.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n The term TB-500 is also used for a separate seven-residue thymosin beta-4 fragment with the sequence\n \u003cstrong\u003eAc-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH\u003c\/strong\u003e,\n abbreviated Ac-LKKTETQ-OH. That shorter fragment is not chemically identical to the full-length 43-residue molecule described on this page.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n The applicable PEP056 Certificate of Analysis should confirm the complete 43-residue sequence, N-terminal acetylation, molecular formula, measured molecular mass and CAS number 77591-33-4. Where analytical testing instead identifies the shorter Ac-LKKTETQ fragment, a separate product page, Certificate of Analysis, Safety Data Sheet and catalogue identity must be used.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT THYMOSIN BETA-4 IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-thymosin-beta-4-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-thymosin-beta-4-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n THYMOSIN BETA-4\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Full-Length 43-Residue Peptide with Additional HPLC Purification\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE full-length Thymosin Beta-4 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis and purification process, the finished 43-residue thymosin beta-4 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual full-length peptide-related, deletion-sequence, truncation, oxidation-related, synthesis-related and process-related impurities further.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification. The applicable analytical method, reporting units, acceptance criterion and batch result should be stated in the corresponding Certificate of Analysis where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard full-length thymosin beta-4 purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- FULL-LENGTH IDENTITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Full-Length Identity Control\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring the complete 43-residue timbetasin sequence rather than a shorter thymosin-derived fragment.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade full-length Thymosin Beta-4 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE Thymosin Beta-4 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Molecular identity, full-length amino-acid sequence, N-terminal acetylation, chromatographic purity, peptide content, molecular form, counter-ion content, methionine oxidation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"thymosin-beta-4-tb500-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eCatalogue Product Name:\u003c\/strong\u003e\n THYMOSIN BETA-4 TB500\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDefined PEP056 Identity:\u003c\/strong\u003e\n Full-length N-terminally acetylated thymosin beta-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Timbetasin\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Thymosin beta-4; Thymosin β4; Tβ4; beta-thymosin 4; full-length human thymosin beta-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCatalogue-Naming Clarification:\u003c\/strong\u003e\n The designation TB500 or TB-500 is used inconsistently. This PEP056 product specifically describes full-length thymosin beta-4 and not the separate seven-residue Ac-LKKTETQ fragment.\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic N-terminally acetylated linear 43-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 43 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Modified Peptide Sequence:\u003c\/strong\u003e\n Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eModified One-Letter Sequence:\u003c\/strong\u003e\n Ac-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Covalently N-acetylated serine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free serine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Structure:\u003c\/strong\u003e\n Linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None; the full-length thymosin beta-4 sequence contains no cysteine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMethionine Content:\u003c\/strong\u003e\n One methionine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSulphur Content:\u003c\/strong\u003e\n The single sulphur atom in the molecular formula is contributed by the methionine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 77591-33-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 16132341\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n 2D5MRE3SSY\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e212\u003c\/sub\u003eH\u003csub\u003e350\u003c\/sub\u003eN\u003csub\u003e56\u003c\/sub\u003eO\u003csub\u003e78\u003c\/sub\u003eS\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 4963.5 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eApproximate Molecular Size:\u003c\/strong\u003e\n 4.96 kDa\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCalculated Monoisotopic Mass:\u003c\/strong\u003e\n Approximately 4960.4863 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the full-length, N-terminally acetylated timbetasin molecule without additional acetate, trifluoroacetate, residual water, solvents or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Identity:\u003c\/strong\u003e\n N-acetylated thymosin beta-4 residues 17–23\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Sequence:\u003c\/strong\u003e\n Ac-Leu-Lys-Lys-Thr-Glu-Thr-Gln-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Shorthand:\u003c\/strong\u003e\n Ac-LKKTETQ-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment CAS Number:\u003c\/strong\u003e\n 885340-08-9\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment PubChem Compound Identifier:\u003c\/strong\u003e\n CID 62707662\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Unique Ingredient Identifier:\u003c\/strong\u003e\n QHK6Z47GTG\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e38\u003c\/sub\u003eH\u003csub\u003e68\u003c\/sub\u003eN\u003csub\u003e10\u003c\/sub\u003eO\u003csub\u003e14\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSeparate TB-500 Fragment Average Molecular Weight:\u003c\/strong\u003e\n Approximately 889.0 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFragment Distinction:\u003c\/strong\u003e\n The seven-residue Ac-LKKTETQ fragment and the full-length 43-residue thymosin beta-4 molecule are separate chemical substances and should not share a Certificate of Analysis, molecular formula, molecular weight or mass-spectrometry acceptance criterion\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic purity represents the relative chromatographic composition measured under the stated analytical conditions and does not by itself establish full-length molecular identity or total net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net full-length thymosin beta-4 content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion, residual-solvent and formulation results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as net timbetasin peptide equivalent or as total supplied salt-form or formulated material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFull-Length Sequence Confirmation:\u003c\/strong\u003e\n The complete 43-residue sequence should be confirmed using the applicable supplier, synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Acetylation Confirmation:\u003c\/strong\u003e\n Product identity should confirm the covalent N-terminal acetyl group using suitable mass-spectrometry or equivalent molecular-identity data\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the free C-terminal serine carboxylic acid structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the complete approximately 4.96 kDa timbetasin molecule rather than the separate seven-residue TB-500 fragment\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is the uncountered parent peptide, an acetate-containing form, a trifluoroacetate-containing form or another counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect the total supplied material mass and calculated net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water may contribute to the total material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage, purification, concentration and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMethionine-Oxidation Control:\u003c\/strong\u003e\n Oxidation of the single methionine residue is a distinct peptide-related quality attribute and should be assessed or controlled where required by the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely acetylated material, methionine oxidation products, incompletely deprotected sequences and other synthesis-related or process-related substances are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, buffer, concentration and mixing procedure should be selected using the applicable batch documentation and validated laboratory method; a universal bacteriostatic-water instruction should not be applied to every thymosin beta-4 chemical form or formulation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, full-length amino-acid sequence, N-terminal acetylation, terminal structure, chromatographic purity, net peptide content, methionine oxidation, water content, residual solvents, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Full-length sequence documentation – The complete 43-residue thymosin beta-4 sequence should be confirmed using the applicable synthesis and batch records.\n \u003cbr\u003e\n\n ✓ N-terminal modification documentation – Covalent N-terminal acetylation should be supported by appropriate molecular-identity data.\n \u003cbr\u003e\n\n ✓ C-terminal structure documentation – The free C-terminal serine carboxylic acid structure should be confirmed using the applicable molecular-identity records.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the complete approximately 4.96 kDa timbetasin molecule.\n \u003cbr\u003e\n\n ✓ Fragment distinction – The analytical documentation should distinguish full-length thymosin beta-4 from the separate seven-residue Ac-LKKTETQ TB-500 fragment.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net full-length thymosin beta-4 content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The parent peptide, acetate-containing material, trifluoroacetate-containing material or another counter-ion presentation should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Oxidation-control documentation – Methionine oxidation should be assessed or controlled where required by the applicable research specification.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or lipopolysaccharide result should identify the analytical method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"thymosin-beta-4-tb500-product-overview\"\u003e\n \u003cstrong\u003eThymosin Beta-4 TB500 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003efull-length Thymosin Beta-4 research-grade peptide\u003c\/strong\u003e,\n also identified by the recognised substance name timbetasin, is supplied for controlled scientific laboratory investigation, analytical method development, full-length peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows and reference-material comparison.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The PEP056 molecular identity comprises a defined linear sequence of 43 amino-acid residues with covalent N-terminal acetylation and a free C-terminal serine carboxylic acid. The molecule contains no cysteine residues and therefore has no intramolecular disulphide bonds. Its single sulphur atom is contributed by the methionine residue within the sequence.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 77591-33-4, molecular formula C\u003csub\u003e212\u003c\/sub\u003eH\u003csub\u003e350\u003c\/sub\u003eN\u003csub\u003e56\u003c\/sub\u003eO\u003csub\u003e78\u003c\/sub\u003eS and average molecular weight of approximately 4963.5 g\/mol describe the full-length, N-terminally acetylated timbetasin molecule. Where the supplied material contains acetate, trifluoroacetate, residual water, solvents or formulation ingredients, the applicable batch documentation should identify their contribution to the total supplied material mass.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Full-length thymosin beta-4 should not be confused with the separate seven-residue material also recorded under the TB-500 name. That fragment has the sequence Ac-LKKTETQ-OH and a molecular weight of approximately 889.0 g\/mol. High-performance liquid chromatography purity alone cannot establish which of these two substances has been supplied; the catalogue identity, complete sequence and mass-spectrometry result must agree.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, full-length amino-acid sequence, N-terminal acetylation, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, methionine oxidation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net peptide content or proof of the complete 43-residue sequence. Likewise, a bacterial endotoxin or lipopolysaccharide result does not establish sterility, full-length molecular identity, correct N-terminal acetylation or the absence of every peptide-related and process-related impurity.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, chromatographic, peptide-characterisation and general laboratory work, the Regular full-length Thymosin Beta-4 specification remains highly suitable. The premium black-and-gold ULTIMATE Thymosin Beta-4 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP056.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP056.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"5mg","offer_id":50022643794258,"sku":"PEP056","price":41.5,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022643827026,"sku":"PEP056","price":76.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022643859794,"sku":"PEP056","price":141.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022643892562,"sku":"PEP056","price":324.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51257697272146,"sku":"PEP056","price":169.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51257698353490,"sku":"PEP056","price":338.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51257699664210,"sku":"PEP056","price":315.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51257700909394,"sku":"PEP056","price":630.5,"currency_code":"GBP","in_stock":true},{"title":"5mg Ultimate","offer_id":54671044739410,"sku":"PEP056U","price":62.5,"currency_code":"GBP","in_stock":true},{"title":"10mg Ultimate","offer_id":54671080915282,"sku":"PEP056U","price":102.5,"currency_code":"GBP","in_stock":true},{"title":"20mg Ultimate","offer_id":54671097692498,"sku":"PEP056U","price":190.5,"currency_code":"GBP","in_stock":true},{"title":"50mg Ultimate","offer_id":54671107457362,"sku":"PEP056U","price":445.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54766528921938,"sku":"PEP056U","price":245.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54766528954706,"sku":"PEP056U","price":490.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54766528987474,"sku":"PEP056U","price":457.5,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766529020242,"sku":"PEP056U","price":914.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-thymosin-beta-4-peptide-uk-pure-fine-powder.png?v=1767887109"},{"product_id":"buy-trh-peptides-online-uk","title":"TRH (Thyrotropin) - Research Grade Peptide","description":"\u003ch3 id=\"trh-thyrotropin-releasing-hormone-research-grade-tripeptide\"\u003e\n \u003cstrong\u003e\n TRH (Thyrotropin-Releasing Hormone)\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, Helvetica, sans-serif;\"\u003e\n – Research-Grade Tripeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n Research-grade, sequence-defined protirelin tripeptide with batch documentation available where supplied\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Defined pyroglutamyl-histidyl-prolinamide molecular structure\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n N-terminal pyroglutamate and C-terminal prolinamide incorporated into the specified molecular identity\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Batch identity, chromatographic purity, molecular mass, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n TRH, also known as thyrotropin-releasing hormone, thyroliberin or protirelin, is a defined tripeptide comprising an N-terminal pyroglutamyl residue, L-histidine and C-terminal L-prolinamide. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage, analytical method development and peptide characterisation. The stated nominal amount refers to the declared protirelin content of a single vial, subject to the applicable batch documentation and stated assay basis.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Where laboratory dissolution or reconstitution is required, the solvent, buffer, concentration, mixing procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal solvent instruction should not be applied to every protirelin chemical form, salt presentation or formulation. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT TRH TERMINOLOGY AND IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 20px 22px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 9px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.5px;\n text-transform: uppercase;\n \"\u003e\n Important Terminology and Molecular Identity Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n This PEP058 listing describes\n \u003cstrong\u003e\n TRH, thyrotropin-releasing hormone or protirelin\n \u003c\/strong\u003e,\n with the defined structure\n \u003cstrong\u003e\n pGlu-His-Pro-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/strong\u003e.\n The term “thyrotropin” should not be used by itself as the product name because thyrotropin ordinarily identifies the separate thyroid-stimulating hormone substance.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n The N-terminal pyroglutamate and C-terminal prolinamide are integral parts of the molecular structure. A free N-terminal glutamine form, C-terminal free-acid form, tartrate salt, acetate-containing form or another derivative would represent a different chemical presentation.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n The applicable Certificate of Analysis should confirm the complete modified sequence, molecular formula, measured molecular mass, chromatographic purity, peptide-content basis and any counter-ion, residual-water or formulation components present in the supplied batch.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT TRH TERMINOLOGY AND IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-trh-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 34px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px 28px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 24%,\n #202020 54%,\n #101010 78%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 22px 50px rgba(0, 0, 0, 0.38),\n 0 0 0 1px rgba(212, 175, 55, 0.09),\n inset 0 1px 0 rgba(255, 239, 170, 0.09),\n inset 0 0 36px rgba(212, 175, 55, 0.04);\n \"\u003e\n \u003c!-- DECORATIVE UPPER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -145px;\n right: -105px;\n width: 380px;\n height: 380px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 31%,\n rgba(212, 175, 55, 0.03) 53%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE LOWER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -175px;\n left: -125px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.16) 0%,\n rgba(212, 175, 55, 0.05) 41%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE GOLD TOP EDGE --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.15),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-trh-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.24),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n TRH\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 9px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.8px;\n text-transform: uppercase;\n \"\u003e\n Additional Preparative HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 12px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.7;\n letter-spacing: 0.1px;\n \"\u003e\n A premium laboratory specification incorporating an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for demanding analytical research workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 26px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE TRH range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of tripeptide purification and batch quality control. Following the standard synthesis, terminal-modification and purification process, the finished TRH research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, deletion-sequence, deamidation-related, synthesis-related and process-related impurities further.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n ULTIMATE batches are also assessed under a more stringent bacterial endotoxin or lipopolysaccharide testing specification. The applicable analytical method, reporting units, acceptance criterion and batch result should be stated in the corresponding Certificate of Analysis where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 28px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard protirelin synthesis and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin or lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM IDENTITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n Intended for laboratory projects requiring additional purification and supporting batch-specific documentation covering sequence identity, terminal modifications, molecular mass and impurity control.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 20px 22px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.06),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.13);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.74;\n \"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, reference-material evaluation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade TRH product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin or lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.64;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE TRH remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Molecular identity, complete modified sequence, stereochemistry, terminal structure, chromatographic purity, net peptide content, molecular form, counter-ion content, residual solvents, water content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"trh-protirelin-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eCatalogue Product Name:\u003c\/strong\u003e\n TRH (Thyrotropin-Releasing Hormone)\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Protirelin\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n TRH; thyrotropin-releasing hormone; thyrotropin-releasing factor; thyroliberin; synthetic TRH; Lopremone\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTerminology Clarification:\u003c\/strong\u003e\n Thyrotropin-releasing hormone should not be shortened to “thyrotropin” in the product title because thyrotropin ordinarily identifies the separate thyroid-stimulating hormone substance\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic sequence-defined pyroglutamyl tripeptide amide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Three amino-acid or modified amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Modified Sequence:\u003c\/strong\u003e\n pGlu-His-Pro-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eExpanded Sequence:\u003c\/strong\u003e\n L-pyroglutamyl-L-histidyl-L-prolinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Structural Shorthand:\u003c\/strong\u003e\n Pyr-His-Pro-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence-Based Chemical Name:\u003c\/strong\u003e\n 5-oxo-L-prolyl-L-histidyl-L-prolinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSystematic Chemical Name:\u003c\/strong\u003e\n (2S)-N-[(2S)-1-[(2S)-2-carbamoylpyrrolidin-1-yl]-3-(1H-imidazol-5-yl)-1-oxopropan-2-yl]-5-oxopyrrolidine-2-carboxamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n L-pyroglutamate, also described as 5-oxo-L-proline\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal L-prolinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTerminal-Modification Note:\u003c\/strong\u003e\n The N-terminal pyroglutamyl ring and C-terminal amide are integral parts of the defined protirelin molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Peptide:\u003c\/strong\u003e\n Linear tripeptide backbone containing a cyclic pyroglutamyl residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 24305-27-9\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 638678\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n 5Y5F15120W\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e16\u003c\/sub\u003eH\u003csub\u003e22\u003c\/sub\u003eN\u003csub\u003e6\u003c\/sub\u003eO\u003csub\u003e4\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 362.38 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eApproximate Monoisotopic Mass:\u003c\/strong\u003e\n 362.1703 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eInChIKey:\u003c\/strong\u003e\n XNSAINXGIQZQOO-SRVKXCTJSA-N\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the parent protirelin molecule containing its N-terminal pyroglutamate and C-terminal prolinamide, without an additional salt component, counter-ion, residual water, solvent or formulation excipient\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic purity represents the relative chromatographic composition measured under the stated analytical conditions and should not automatically be interpreted as equivalent to total net protirelin content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net protirelin content should be distinguished from chromatographic purity and interpreted alongside water content, counter-ion content, residual solvents and formulation components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as anhydrous parent protirelin equivalent or as total supplied salt-form or formulated lyophilised material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The complete pGlu-His-Pro-NH\u003csub\u003e2\u003c\/sub\u003e sequence should be confirmed using the applicable supplier, synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStereochemical Confirmation:\u003c\/strong\u003e\n The specified L configuration of the pyroglutamyl, histidyl and prolinamide components should be supported by suitable synthesis records or analytical documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Modification Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the pyroglutamyl residue and distinguish it from an uncyclised glutamine or glutamic-acid terminal form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Amidation Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the C-terminal prolinamide and distinguish it from the corresponding free carboxylic acid derivative\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the specified protirelin structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is parent protirelin, a tartrate-containing form, an acetate-containing form or another salt or counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Tartrate, acetate, trifluoroacetate or another counter-ion may affect the total supplied material mass, formula weight and calculated net protirelin content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water and hydration state may contribute to the total material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage, purification, concentration and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Uncyclised N-terminal material, C-terminal free-acid material, deletion products, truncated material, deamidated products and other synthesis-related or process-related substances are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, buffer, concentration and mixing procedure should be selected using the applicable batch documentation and validated laboratory method; a universal bacteriostatic-water instruction should not be applied to every protirelin chemical form or preparation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, modified sequence, stereochemistry, terminal structure, chromatographic purity, net peptide content, salt form, water content, residual solvents and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n ✓ \u003cstrong\u003eBatch documentation\u003c\/strong\u003e – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eCertificate of Analysis\u003c\/strong\u003e – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSafety Data Sheet\u003c\/strong\u003e – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSequence documentation\u003c\/strong\u003e – The complete pGlu-His-Pro-NH\u003csub\u003e2\u003c\/sub\u003e structure should be confirmed using the applicable synthesis and batch records.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eN-terminal modification documentation\u003c\/strong\u003e – The pyroglutamyl residue should be supported by appropriate molecular-identity data.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eC-terminal modification documentation\u003c\/strong\u003e – C-terminal prolinamide should be confirmed and distinguished from a free carboxylic acid structure.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eMass-spectrometry documentation\u003c\/strong\u003e – Molecular identity should be supported by analytical mass data consistent with the specified protirelin structure.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003ePurity documentation\u003c\/strong\u003e – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003ePeptide-content documentation\u003c\/strong\u003e – Net protirelin content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eChemical-form documentation\u003c\/strong\u003e – Parent protirelin, tartrate-containing, acetate-containing or another salt form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eRelated-substance documentation\u003c\/strong\u003e – Terminally modified, deamidated, deletion-sequence and other process-related impurities should be controlled as applicable.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eBacterial endotoxin documentation\u003c\/strong\u003e – The applicable bacterial endotoxin or lipopolysaccharide result should identify the analytical method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSupplier documentation\u003c\/strong\u003e – Reviewed where supporting synthesis, terminal-modification, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eTrackable laboratory delivery\u003c\/strong\u003e – Securely packaged and dispatched using transport controls appropriate to the applicable batch stability and storage specification.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp style=\"color: #c00000; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor Research Use Only\u003c\/strong\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"trh-protirelin-product-overview\"\u003e\n \u003cstrong\u003eTRH and Protirelin Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Our\n \u003cstrong\u003eTRH research-grade protirelin tripeptide\u003c\/strong\u003e\n is supplied for controlled analytical method development, peptide identity assessment, high-performance liquid chromatography evaluation, liquid chromatography–mass spectrometry workflows, impurity profiling, reference-material comparison and other scientific laboratory investigations.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Protirelin comprises the defined modified sequence pGlu-His-Pro-NH\u003csub\u003e2\u003c\/sub\u003e. The molecule contains an N-terminal L-pyroglutamyl residue, an L-histidyl residue and a C-terminal L-prolinamide. Both terminal structures form part of the molecular identity and should be confirmed together with the peptide sequence and molecular mass.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The CAS number 24305-27-9, molecular formula C\u003csub\u003e16\u003c\/sub\u003eH\u003csub\u003e22\u003c\/sub\u003eN\u003csub\u003e6\u003c\/sub\u003eO\u003csub\u003e4\u003c\/sub\u003e and average molecular weight of approximately 362.38 g\/mol describe the parent protirelin molecule. Where the supplied laboratory material contains tartrate, acetate, trifluoroacetate, residual water, solvents or formulation ingredients, the applicable batch documentation should identify their contribution to the total supplied material mass.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The product should be described as TRH, thyrotropin-releasing hormone, thyroliberin or protirelin. The shortened description “thyrotropin” is not appropriate because it refers to a different hormone substance and may create avoidable catalogue, analytical and documentation ambiguity.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net protirelin content or proof of correct N-terminal pyroglutamate formation and C-terminal amidation. Molecular identity should be assessed using the applicable combination of chromatographic, mass-spectrometry, peptide-content and batch-manufacturing documentation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility, complete molecular identity, correct terminal modification or the absence of every peptide-related and process-related impurity. Any sterility claim must be supported separately by an appropriate validated sterility test and controlled production documentation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, impurity profiling and general laboratory work, the\n \u003cstrong\u003eRegular TRH specification remains highly suitable\u003c\/strong\u003e.\n The premium black-and-gold ULTIMATE TRH option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for projects requiring enhanced quality-control parameters.\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP058.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP058.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"5mg","offer_id":50022687211858,"sku":"PEP058","price":17.25,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022687244626,"sku":"PEP058","price":31.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022687277394,"sku":"PEP058","price":57.25,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022687310162,"sku":"PEP058","price":130.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51257717686610,"sku":"PEP058","price":68.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51257719128402,"sku":"PEP058","price":135.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51257720668498,"sku":"PEP058","price":126.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51257727746386,"sku":"PEP058","price":252.25,"currency_code":"GBP","in_stock":true},{"title":"5mg Ultimate","offer_id":54670948794706,"sku":"PEP058U","price":29.95,"currency_code":"GBP","in_stock":true},{"title":"10mg Ultimate","offer_id":54670960984402,"sku":"PEP058U","price":56.85,"currency_code":"GBP","in_stock":true},{"title":"20mg Ultimate","offer_id":54670977565010,"sku":"PEP058U","price":85.95,"currency_code":"GBP","in_stock":true},{"title":"50mg Ultimate","offer_id":54671002403154,"sku":"PEP058U","price":189.85,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-trh-peptides-online-uk-pure-fine-peptide-powder.png?v=1767865800"},{"product_id":"buy-triptorelin-peptide-uk","title":"TRIPTORELIN (GNRH) - Research Grade Peptide","description":"\u003ch3 id=\"triptorelin-gnrh-analogue-research-grade-decapeptide\"\u003e\n \u003cstrong\u003e\n TRIPTORELIN (GnRH Analogue)\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, Helvetica, sans-serif;\"\u003e\n – Research-Grade Synthetic Decapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n Research-grade, sequence-defined synthetic decapeptide with batch documentation available where supplied\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Defined pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH\u003csub\u003e2\u003c\/sub\u003e molecular structure\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Contains D-tryptophan at position 6, an N-terminal pyroglutamate and a C-terminal glycinamide\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Batch identity, chromatographic purity, molecular mass, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Supply may be subject to customer, organisation and intended-use verification\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Triptorelin is a sequence-defined synthetic decapeptide analogue of gonadotropin-releasing hormone. It is not chemically identical to native GnRH. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage, analytical method development and peptide characterisation. The stated nominal amount refers to the declared triptorelin peptide content of a single vial, subject to the applicable batch documentation and stated assay basis.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Where laboratory dissolution or reconstitution is required, the solvent, buffer, concentration, mixing procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal solvent instruction should not be applied to every triptorelin chemical form, counter-ion presentation or formulated preparation. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n\u003c\/p\u003e\n\n\u003c!-- PROFESSIONAL LABORATORY SUPPLY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 20px 22px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 9px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.5px;\n text-transform: uppercase;\n \"\u003e\n Professional Laboratory Supply\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n This research material is supplied solely for legitimate scientific, analytical and laboratory applications. Orders may be reviewed to confirm the purchasing organisation, professional delivery address, intended laboratory application and any additional due-diligence information reasonably required by Research Scientific Ltd.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n This listing does not represent the material as an authorised finished medicinal product. It must not be purchased or used for personal, clinical, diagnostic, pharmacy-compounding, veterinary or self-administration purposes.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END PROFESSIONAL LABORATORY SUPPLY NOTICE --\u003e\n\n\u003c!-- IMPORTANT TRIPTORELIN IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 20px 22px;\n background: linear-gradient(135deg, #f8f8f8 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 9px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.5px;\n text-transform: uppercase;\n \"\u003e\n Important Molecular and Chemical-Form Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n This PEP059 listing describes the parent triptorelin peptide with the complete structure\n \u003cstrong\u003e\n pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/strong\u003e,\n CAS number 57773-63-4 and molecular formula\n C\u003csub\u003e64\u003c\/sub\u003eH\u003csub\u003e82\u003c\/sub\u003eN\u003csub\u003e18\u003c\/sub\u003eO\u003csub\u003e13\u003c\/sub\u003e.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n Triptorelin is a modified GnRH analogue and should not be listed as chemically identical to native gonadotropin-releasing hormone. The substitution of D-tryptophan at position 6 forms part of the defined triptorelin molecular identity.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n Triptorelin acetate is a separate chemical form with CAS number 140194-24-7, reference formula\n C\u003csub\u003e64\u003c\/sub\u003eH\u003csub\u003e82\u003c\/sub\u003eN\u003csub\u003e18\u003c\/sub\u003eO\u003csub\u003e13\u003c\/sub\u003e·C\u003csub\u003e2\u003c\/sub\u003eH\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e2\u003c\/sub\u003e\n and molecular weight approximately 1371.52 g\/mol.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n Triptorelin pamoate is another separate salt form with the reference formula\n C\u003csub\u003e64\u003c\/sub\u003eH\u003csub\u003e82\u003c\/sub\u003eN\u003csub\u003e18\u003c\/sub\u003eO\u003csub\u003e13\u003c\/sub\u003e·C\u003csub\u003e23\u003c\/sub\u003eH\u003csub\u003e16\u003c\/sub\u003eO\u003csub\u003e6\u003c\/sub\u003e\n and molecular weight approximately 1699.9 g\/mol.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n The applicable Certificate of Analysis and Safety Data Sheet must identify the precise parent peptide, acetate, pamoate or other supplied form. The CAS number, formula, molecular weight, counter-ion content and declared vial-quantity basis should correspond to the material actually supplied.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT TRIPTORELIN IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-triptorelin-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 34px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px 28px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 24%,\n #202020 54%,\n #101010 78%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 22px 50px rgba(0, 0, 0, 0.38),\n 0 0 0 1px rgba(212, 175, 55, 0.09),\n inset 0 1px 0 rgba(255, 239, 170, 0.09),\n inset 0 0 36px rgba(212, 175, 55, 0.04);\n \"\u003e\n \u003c!-- DECORATIVE UPPER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -145px;\n right: -105px;\n width: 380px;\n height: 380px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 31%,\n rgba(212, 175, 55, 0.03) 53%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE LOWER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -175px;\n left: -125px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.16) 0%,\n rgba(212, 175, 55, 0.05) 41%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE GOLD TOP EDGE --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.15),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-triptorelin-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.24),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n TRIPTORELIN\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 9px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.8px;\n text-transform: uppercase;\n \"\u003e\n Additional Preparative HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 12px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.7;\n letter-spacing: 0.1px;\n \"\u003e\n A premium laboratory specification incorporating an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for demanding analytical research workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 26px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE Triptorelin range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and batch quality control. Following the standard synthesis, terminal-modification and purification process, the finished Triptorelin research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, deletion-sequence, stereochemical, terminal-modification, synthesis-related and process-related impurities further.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n ULTIMATE batches are also assessed under a more stringent bacterial endotoxin or lipopolysaccharide testing specification. The applicable analytical method, reporting units, acceptance criterion, method-suitability controls and batch result should be stated in the corresponding Certificate of Analysis where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 28px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard Triptorelin synthesis and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin or lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM IDENTITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n Intended for analytical projects requiring additional purification and supporting batch-specific documentation covering sequence identity, D-tryptophan configuration, terminal modifications, molecular mass and impurity control.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 20px 22px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.06),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.13);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.74;\n \"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, reference-material evaluation, peptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade Triptorelin product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin or lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.64;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE Triptorelin remains strictly for verified scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use, pharmacy compounding, self-administration or therapeutic application. Molecular identity, complete sequence, stereochemistry, terminal modifications, chromatographic purity, net peptide content, molecular form, counter-ion content, residual solvents, water content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"triptorelin-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n TRIPTORELIN\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Triptorelin\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Scientific Names:\u003c\/strong\u003e\n [D-Trp\u003csup\u003e6\u003c\/sup\u003e]-GnRH; [D-Trp\u003csup\u003e6\u003c\/sup\u003e]-LHRH; D-Trp\u003csup\u003e6\u003c\/sup\u003e gonadorelin; 6-D-tryptophan luteinising hormone-releasing hormone\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eGnRH Relationship:\u003c\/strong\u003e\n Synthetic decapeptide analogue of gonadotropin-releasing hormone; not chemically identical to native GnRH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic sequence-defined modified linear decapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Ten amino-acid and modified amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Modified Peptide Sequence:\u003c\/strong\u003e\n pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eExpanded Sequence:\u003c\/strong\u003e\n L-pyroglutamyl-L-histidyl-L-tryptophyl-L-seryl-L-tyrosyl-D-tryptophyl-L-leucyl-L-arginyl-L-prolylglycinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSystematic Sequence-Based Description:\u003c\/strong\u003e\n 5-oxo-L-prolyl-L-histidyl-L-tryptophyl-L-seryl-L-tyrosyl-D-tryptophyl-L-leucyl-L-arginyl-L-prolylglycinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePosition 6 Modification:\u003c\/strong\u003e\n D-tryptophan replaces the glycine residue present at position 6 of native GnRH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n L-pyroglutamate, also described as 5-oxo-L-proline\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal glycinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTerminal-Modification Note:\u003c\/strong\u003e\n The N-terminal pyroglutamyl residue and C-terminal amide form part of the defined triptorelin molecular identity\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Peptide:\u003c\/strong\u003e\n Linear peptide backbone containing a cyclic pyroglutamyl residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None; the triptorelin sequence contains no cysteine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSulphur Content:\u003c\/strong\u003e\n None; the parent molecular formula contains no sulphur\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Triptorelin CAS Number:\u003c\/strong\u003e\n 57773-63-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Triptorelin PubChem Compound Identifier:\u003c\/strong\u003e\n CID 25074470\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Triptorelin Unique Ingredient Identifier:\u003c\/strong\u003e\n 9081Y98W2V\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Triptorelin Molecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e64\u003c\/sub\u003eH\u003csub\u003e82\u003c\/sub\u003eN\u003csub\u003e18\u003c\/sub\u003eO\u003csub\u003e13\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Triptorelin Average Molecular Weight:\u003c\/strong\u003e\n Approximately 1311.47 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent Triptorelin Approximate Monoisotopic Mass:\u003c\/strong\u003e\n 1310.6309 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eParent-Formula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the uncountered parent triptorelin structure containing its N-terminal pyroglutamate, D-tryptophan residue and C-terminal glycinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTriptorelin Acetate CAS Number:\u003c\/strong\u003e\n 140194-24-7\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTriptorelin Acetate Unique Ingredient Identifier:\u003c\/strong\u003e\n 43OFW291R9\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Triptorelin Acetate Formula:\u003c\/strong\u003e\n C\u003csub\u003e64\u003c\/sub\u003eH\u003csub\u003e82\u003c\/sub\u003eN\u003csub\u003e18\u003c\/sub\u003eO\u003csub\u003e13\u003c\/sub\u003e·C\u003csub\u003e2\u003c\/sub\u003eH\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eExpanded Triptorelin Acetate Formula:\u003c\/strong\u003e\n C\u003csub\u003e66\u003c\/sub\u003eH\u003csub\u003e86\u003c\/sub\u003eN\u003csub\u003e18\u003c\/sub\u003eO\u003csub\u003e15\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Triptorelin Acetate Average Molecular Weight:\u003c\/strong\u003e\n Approximately 1371.52 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAcetate-Form Distinction:\u003c\/strong\u003e\n Triptorelin acetate is a separate supplied salt form and should not be represented using the unqualified molecular formula or molecular weight of the parent peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Triptorelin Pamoate Formula:\u003c\/strong\u003e\n C\u003csub\u003e64\u003c\/sub\u003eH\u003csub\u003e82\u003c\/sub\u003eN\u003csub\u003e18\u003c\/sub\u003eO\u003csub\u003e13\u003c\/sub\u003e·C\u003csub\u003e23\u003c\/sub\u003eH\u003csub\u003e16\u003c\/sub\u003eO\u003csub\u003e6\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eExpanded Triptorelin Pamoate Formula:\u003c\/strong\u003e\n C\u003csub\u003e87\u003c\/sub\u003eH\u003csub\u003e98\u003c\/sub\u003eN\u003csub\u003e18\u003c\/sub\u003eO\u003csub\u003e19\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Triptorelin Pamoate Average Molecular Weight:\u003c\/strong\u003e\n Approximately 1699.9 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePamoate-Form Distinction:\u003c\/strong\u003e\n Triptorelin pamoate is chemically distinct from both parent triptorelin and triptorelin acetate\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eBrand-Name Distinction:\u003c\/strong\u003e\n Proprietary medicinal brand names should not be used as substitutes for the precise chemical identity of the research material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic purity represents the relative chromatographic composition measured under the stated analytical conditions and should not automatically be interpreted as equivalent to total net triptorelin peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net triptorelin peptide content should be distinguished from chromatographic purity and interpreted alongside counter-ion content, water content, residual solvents and formulation components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as parent triptorelin equivalent, total acetate-form material, total pamoate-form material or total formulated lyophilised material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The complete ten-residue modified sequence should be confirmed using the applicable supplier, synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eD-Tryptophan Confirmation:\u003c\/strong\u003e\n The D configuration of the tryptophan residue at position 6 should be supported by appropriate synthesis records or stereochemical analytical documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Pyroglutamate Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the pyroglutamyl residue and distinguish it from an uncyclised glutamine or glutamic-acid terminal form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Amidation Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the C-terminal glycinamide and distinguish it from the corresponding free carboxylic acid derivative\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the exact triptorelin parent or salt form stated for the applicable batch\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is parent triptorelin, triptorelin acetate, triptorelin pamoate, a trifluoroacetate-containing form or another salt or counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Acetate, pamoate, trifluoroacetate or another counter-ion may affect the total supplied material mass, formula weight and calculated net triptorelin content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water and hydration state may contribute to the total supplied material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage, purification, salt conversion, concentration and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely modified termini, stereochemical impurities, oxidation products and other synthesis-related or process-related substances are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAggregation and Physical State:\u003c\/strong\u003e\n Aggregation, oligomerisation and other concentration-dependent physical behaviour are separate quality attributes and are not established by a chromatographic purity percentage alone\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, buffer, concentration and mixing procedure should be selected using the applicable batch documentation and validated laboratory method; a universal bacteriostatic-water instruction should not be applied to every triptorelin chemical form or preparation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, complete modified sequence, stereochemistry, terminal structure, chromatographic purity, net peptide content, salt form, water content, residual solvents and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n ✓ \u003cstrong\u003eBatch documentation\u003c\/strong\u003e – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eCertificate of Analysis\u003c\/strong\u003e – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSafety Data Sheet\u003c\/strong\u003e – Supplied to support appropriate professional laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSequence documentation\u003c\/strong\u003e – The complete pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH\u003csub\u003e2\u003c\/sub\u003e structure should be confirmed using the applicable synthesis and batch records.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eStereochemical documentation\u003c\/strong\u003e – The D-tryptophan residue at position 6 should be supported by appropriate synthesis or analytical documentation.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eN-terminal modification documentation\u003c\/strong\u003e – The pyroglutamyl residue should be supported by appropriate molecular-identity data.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eC-terminal modification documentation\u003c\/strong\u003e – C-terminal glycinamide should be confirmed and distinguished from a free carboxylic acid structure.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eMass-spectrometry documentation\u003c\/strong\u003e – Molecular identity should be supported by analytical mass data consistent with the specified parent or salt-form structure.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003ePurity documentation\u003c\/strong\u003e – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003ePeptide-content documentation\u003c\/strong\u003e – Net triptorelin content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eChemical-form documentation\u003c\/strong\u003e – Parent triptorelin, acetate, pamoate, trifluoroacetate-containing material or another salt form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eRelated-substance documentation\u003c\/strong\u003e – Deletion sequences, stereochemical impurities, terminally modified products and other process-related substances should be controlled as applicable.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eBacterial endotoxin documentation\u003c\/strong\u003e – The applicable bacterial endotoxin or lipopolysaccharide result should identify the analytical method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSupplier documentation\u003c\/strong\u003e – Reviewed where supporting synthesis, terminal modification, purification, salt-form and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eTrackable laboratory delivery\u003c\/strong\u003e – Securely packaged and dispatched using transport controls appropriate to the applicable batch stability and storage specification.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp style=\"color: #c00000; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor Research Use Only\u003c\/strong\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use, pharmacy compounding, self-administration or any form of therapeutic application.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"triptorelin-product-overview\"\u003e\n \u003cstrong\u003eTriptorelin Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Our\n \u003cstrong\u003eresearch-grade Triptorelin synthetic decapeptide\u003c\/strong\u003e\n is supplied for controlled analytical method development, peptide identity assessment, high-performance liquid chromatography evaluation, liquid chromatography–mass spectrometry workflows, impurity profiling, reference-material comparison and other verified scientific laboratory investigations.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Triptorelin comprises the defined sequence pGlu-His-Trp-Ser-Tyr-D-Trp-Leu-Arg-Pro-Gly-NH\u003csub\u003e2\u003c\/sub\u003e. The molecule contains an N-terminal pyroglutamyl residue, D-tryptophan at position 6 and a C-terminal glycinamide. These structural features form part of the molecular identity and should be confirmed together with the peptide sequence, stereochemistry and measured molecular mass.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Triptorelin is a modified analogue of gonadotropin-releasing hormone rather than an alternative name for native GnRH. The product title and scientific documentation should therefore use wording such as\n \u003cstrong\u003eTriptorelin – GnRH Analogue\u003c\/strong\u003e\n rather than presenting Triptorelin and GnRH as chemically identical substances.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The CAS number 57773-63-4, molecular formula C\u003csub\u003e64\u003c\/sub\u003eH\u003csub\u003e82\u003c\/sub\u003eN\u003csub\u003e18\u003c\/sub\u003eO\u003csub\u003e13\u003c\/sub\u003e and average molecular weight of approximately 1311.47 g\/mol describe the uncountered parent triptorelin molecule. Where the supplied laboratory material contains acetate, pamoate, trifluoroacetate, residual water, solvents or formulation ingredients, the applicable batch documentation should identify their contribution to the total supplied material mass.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Triptorelin acetate and triptorelin pamoate are distinct supplied chemical forms. Triptorelin acetate has the reference formula C\u003csub\u003e64\u003c\/sub\u003eH\u003csub\u003e82\u003c\/sub\u003eN\u003csub\u003e18\u003c\/sub\u003eO\u003csub\u003e13\u003c\/sub\u003e·C\u003csub\u003e2\u003c\/sub\u003eH\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e2\u003c\/sub\u003e and molecular weight approximately 1371.52 g\/mol, while the reference pamoate form has the formula C\u003csub\u003e64\u003c\/sub\u003eH\u003csub\u003e82\u003c\/sub\u003eN\u003csub\u003e18\u003c\/sub\u003eO\u003csub\u003e13\u003c\/sub\u003e·C\u003csub\u003e23\u003c\/sub\u003eH\u003csub\u003e16\u003c\/sub\u003eO\u003csub\u003e6\u003c\/sub\u003e and molecular weight approximately 1699.9 g\/mol.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, complete amino-acid sequence, D-tryptophan configuration, terminal modifications, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, aggregation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net triptorelin content or proof of correct stereochemistry and terminal modification. Molecular identity should be assessed using the applicable combination of chromatographic, mass-spectrometry, peptide-content and batch-manufacturing documentation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility, complete molecular identity, correct D-tryptophan configuration, terminal-modification integrity or the absence of every peptide-related and process-related impurity. Any sterility claim must be supported separately by an appropriate validated sterility test and controlled production documentation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, impurity profiling, peptide-characterisation and general laboratory work, the\n \u003cstrong\u003eRegular Triptorelin specification remains highly suitable\u003c\/strong\u003e.\n The premium black-and-gold ULTIMATE Triptorelin option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for projects requiring enhanced quality-control parameters.\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP059.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP059.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"5mg","offer_id":50022715326802,"sku":"PEP059","price":79.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022715359570,"sku":"PEP059","price":147.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022715392338,"sku":"PEP059","price":272.5,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022715425106,"sku":"PEP059","price":627.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51257732464978,"sku":"PEP059","price":327.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51257732661586,"sku":"PEP059","price":653.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51257733284178,"sku":"PEP059","price":609.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51257734070610,"sku":"PEP059","price":1218.95,"currency_code":"GBP","in_stock":true},{"title":"5mg Ultimate","offer_id":54670875394386,"sku":"PEP059U","price":104.25,"currency_code":"GBP","in_stock":true},{"title":"10mg Ultimate","offer_id":54670881325394,"sku":"PEP059U","price":198.5,"currency_code":"GBP","in_stock":true},{"title":"20mg Ultimate","offer_id":54670899511634,"sku":"PEP059U","price":348.25,"currency_code":"GBP","in_stock":true},{"title":"50mg Ultimate","offer_id":54670911209810,"sku":"PEP059U","price":859.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54766528692562,"sku":"PEP059U","price":474.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54766528725330,"sku":"PEP059U","price":947.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54766528758098,"sku":"PEP059U","price":884.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766528790866,"sku":"PEP059U","price":1767.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-triptorelin-peptide-uk-pure-fine-powder.png?v=1767865799"},{"product_id":"buy-vilon-research-peptide","title":"VILON - Research Grade Peptide","description":"\u003ch3 id=\"vilon-lys-glu-research-grade-dipeptide\"\u003e\n \u003cstrong\u003e\n VILON\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, Helvetica, sans-serif;\"\u003e\n – Research-Grade Lys-Glu Dipeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n Research-grade, sequence-defined L-lysyl-L-glutamic acid dipeptide\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Defined H-Lys-Glu-OH structure comprising two L-amino-acid residues\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Batch documentation available where supplied for the applicable production lot\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Batch identity, chromatographic purity, molecular mass, dipeptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Vilon is a short synthetic dipeptide comprising L-lysine followed by L-glutamic acid. It is also identified as L-lysyl-L-glutamic acid, Lys-Glu, the KE dipeptide and H-Lys-Glu-OH. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage, analytical method development and dipeptide characterisation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n The stated nominal amount refers to the declared Vilon or L-lysyl-L-glutamic acid content of a single vial, subject to the applicable batch documentation and stated assay basis. Total vial mass may additionally include residual water, counter-ions or declared formulation components, which should be identified separately in the applicable Certificate of Analysis.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Where laboratory dissolution is required, the solvent, buffer, concentration, mixing procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal bacteriostatic-water instruction should not be applied to every Vilon chemical form or laboratory preparation. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT VILON IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 20px 22px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 9px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.5px;\n text-transform: uppercase;\n \"\u003e\n Important Molecular Identity Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n This PEP060 listing describes the single, sequence-defined dipeptide\n \u003cstrong\u003eH-L-Lys-L-Glu-OH\u003c\/strong\u003e,\n also written as Lys-Glu or KE. It contains an ordinary alpha-peptide bond connecting the L-lysine and L-glutamic acid residues.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n Vilon should not be confused with a physical mixture of free L-lysine and L-glutamic acid, the sequence-reversed Glu-Lys dipeptide, a peptide extract or an unspecified multi-component preparation. Those materials do not have the same molecular identity as L-lysyl-L-glutamic acid.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n Normophthal appears in some chemical-registry and catalogue synonym lists for lysylglutamic acid, but the name may also be used commercially for preparations whose composition is not established solely by the trade name. Product identity should therefore be confirmed using the sequence, CAS number, molecular formula and batch analytical documentation.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT VILON IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-vilon-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 34px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px 28px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 24%,\n #202020 54%,\n #101010 78%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 22px 50px rgba(0, 0, 0, 0.38),\n 0 0 0 1px rgba(212, 175, 55, 0.09),\n inset 0 1px 0 rgba(255, 239, 170, 0.09),\n inset 0 0 36px rgba(212, 175, 55, 0.04);\n \"\u003e\n \u003c!-- DECORATIVE UPPER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -145px;\n right: -105px;\n width: 380px;\n height: 380px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 31%,\n rgba(212, 175, 55, 0.03) 53%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE LOWER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -175px;\n left: -125px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.16) 0%,\n rgba(212, 175, 55, 0.05) 41%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE GOLD TOP EDGE --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.15),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-vilon-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.24),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n VILON\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 9px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.8px;\n text-transform: uppercase;\n \"\u003e\n Additional Preparative HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 12px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.7;\n letter-spacing: 0.1px;\n \"\u003e\n A premium laboratory specification incorporating an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for demanding analytical research workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 26px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE Vilon range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of dipeptide purification and batch quality control. Following the standard synthesis and purification process, the finished Vilon research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual dipeptide-related, sequence-related, synthesis-related and process-related impurities further.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n ULTIMATE batches are also assessed under a more stringent bacterial endotoxin or lipopolysaccharide testing specification. The applicable analytical method, reporting units, method-suitability controls, acceptance criterion and batch result should be stated in the corresponding Certificate of Analysis where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 28px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard Lys-Glu synthesis and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin or lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM BATCH SPECIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n Intended for analytical projects requiring additional purification and supporting batch-specific documentation covering sequence identity, stereochemistry, molecular mass and impurity control.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 20px 22px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.06),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.13);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.74;\n \"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, reference-material evaluation, dipeptide characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade Vilon product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of material quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin or lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.64;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE Vilon remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Molecular identity, complete sequence, stereochemistry, chromatographic purity, net dipeptide content, molecular form, counter-ion content, residual solvents, water content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"vilon-lysylglutamic-acid-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n VILON\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Chemical Name:\u003c\/strong\u003e\n L-Lysyl-L-glutamic acid\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Vilon; Lysylglutamic acid; Lys-Glu; L-Lys-L-Glu; Lysylglutamate; KE dipeptide; H-Lys-Glu-OH; N-L-lysyl-L-glutamic acid\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eQualified Catalogue Alias:\u003c\/strong\u003e\n Normophthal appears in some substance and catalogue synonym lists, but product identity should not be assigned solely from this trade name\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic sequence-defined linear dipeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Two amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Peptide Sequence:\u003c\/strong\u003e\n H-L-Lys-L-Glu-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eThree-Letter Sequence:\u003c\/strong\u003e\n Lys-Glu\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n KE\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIUPAC Name:\u003c\/strong\u003e\n (2S)-2-[[(2S)-2,6-diaminohexanoyl]amino]pentanedioic acid\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Bond Structure:\u003c\/strong\u003e\n Standard alpha-peptide bond connecting the alpha-carboxyl group of L-lysine to the alpha-amino group of L-glutamic acid\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free L-lysine alpha-amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eLysine Side-Chain Structure:\u003c\/strong\u003e\n Free epsilon-amino group\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free L-glutamic acid alpha-carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAdditional Acidic Group:\u003c\/strong\u003e\n Free L-glutamic acid side-chain carboxylic acid\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Structure:\u003c\/strong\u003e\n Linear dipeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSulphur Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 45234-02-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 7010502\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n H34V7IM5ML\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e11\u003c\/sub\u003eH\u003csub\u003e21\u003c\/sub\u003eN\u003csub\u003e3\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 275.30 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMonoisotopic Mass:\u003c\/strong\u003e\n Approximately 275.1481 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eInChIKey:\u003c\/strong\u003e\n UGTZHPSKYRIGRJ-YUMQZZPRSA-N\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the uncountered L-Lys-L-Glu free-acid molecule without additional acetate, trifluoroacetate, sodium, residual water, solvent or formulation components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic purity represents the relative chromatographic composition measured under the stated analytical conditions and should not automatically be interpreted as equivalent to total net Vilon content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDipeptide-Content Specification:\u003c\/strong\u003e\n Net L-Lys-L-Glu content should be distinguished from chromatographic purity and interpreted alongside counter-ion content, water content, residual solvents and formulation components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as anhydrous Vilon equivalent or as total supplied salt-form or formulated lyophilised material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The Lys-Glu sequence should be confirmed using the applicable supplier, synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence-Direction Confirmation:\u003c\/strong\u003e\n L-Lys-L-Glu should be distinguished from the sequence-reversed L-Glu-L-Lys dipeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStereochemical Confirmation:\u003c\/strong\u003e\n The L configuration of both the lysine and glutamic acid residues should be supported by suitable synthesis records or analytical documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Amino-Acid Distinction:\u003c\/strong\u003e\n A physical mixture of free L-lysine and L-glutamic acid is not chemically identical to the covalently linked Lys-Glu dipeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the specified L-lysyl-L-glutamic acid structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is the uncountered parent dipeptide, a sodium-containing form, an acetate-containing form, a trifluoroacetate-containing form or another salt presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Sodium, acetate, trifluoroacetate or another counter-ion may affect the total supplied material mass, formula weight and calculated net Vilon content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water and hydration state may contribute to the total material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from synthesis, cleavage, purification, concentration and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Free lysine, free glutamic acid, sequence-reversed Glu-Lys, incomplete coupling products, stereochemical impurities and other synthesis-related or process-related substances are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, buffer, concentration and mixing procedure should be selected using the applicable batch documentation and validated laboratory method; a universal bacteriostatic-water instruction should not be applied to every Vilon preparation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, sequence direction, stereochemistry, chromatographic purity, net dipeptide content, salt form, water content, residual solvents and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n ✓ \u003cstrong\u003eBatch documentation\u003c\/strong\u003e – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eCertificate of Analysis\u003c\/strong\u003e – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSafety Data Sheet\u003c\/strong\u003e – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSequence documentation\u003c\/strong\u003e – The defined H-Lys-Glu-OH structure should be confirmed using the applicable synthesis and batch records.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eStereochemical documentation\u003c\/strong\u003e – The L configuration of both amino-acid residues should be supported by appropriate synthesis or analytical records.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSequence-direction documentation\u003c\/strong\u003e – Lys-Glu should be distinguished from Glu-Lys and from a physical mixture of the two free amino acids.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eMass-spectrometry documentation\u003c\/strong\u003e – Molecular identity should be supported by analytical mass data consistent with the specified Vilon structure.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003ePurity documentation\u003c\/strong\u003e – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eDipeptide-content documentation\u003c\/strong\u003e – Net Vilon content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eChemical-form documentation\u003c\/strong\u003e – The parent dipeptide, sodium-containing, acetate-containing, trifluoroacetate-containing or another salt form should be identified clearly.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eRelated-substance documentation\u003c\/strong\u003e – Free amino acids, incomplete coupling products, sequence-reversed material and stereochemical impurities should be controlled as applicable.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eBacterial endotoxin documentation\u003c\/strong\u003e – The applicable bacterial endotoxin or lipopolysaccharide result should identify the analytical method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSupplier documentation\u003c\/strong\u003e – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eTrackable laboratory delivery\u003c\/strong\u003e – Securely packaged and dispatched using transport controls appropriate to the applicable batch stability and storage specification.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp style=\"color: #c00000; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor Research Use Only\u003c\/strong\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"vilon-product-overview\"\u003e\n \u003cstrong\u003eVilon Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Our\n \u003cstrong\u003eresearch-grade Vilon Lys-Glu dipeptide\u003c\/strong\u003e\n is supplied for controlled analytical method development, short-peptide identity assessment, high-performance liquid chromatography evaluation, liquid chromatography–mass spectrometry workflows, impurity profiling, reference-material comparison and other scientific laboratory investigations.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Vilon comprises two covalently linked L-amino-acid residues in the defined sequence L-lysine followed by L-glutamic acid. The sequence may be written as Lys-Glu, KE or H-Lys-Glu-OH. The intact dipeptide should be distinguished from the individual free amino acids and from the sequence-reversed Glu-Lys molecule.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The CAS number 45234-02-4, molecular formula C\u003csub\u003e11\u003c\/sub\u003eH\u003csub\u003e21\u003c\/sub\u003eN\u003csub\u003e3\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e and average molecular weight of approximately 275.30 g\/mol describe the uncountered L-lysyl-L-glutamic acid molecule. Where the supplied laboratory material contains sodium, acetate, trifluoroacetate, residual water, solvents or formulation ingredients, the applicable batch documentation should identify their contribution to the total supplied material mass.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, sequence direction, stereochemical configuration, chromatographic purity, net dipeptide content, molecular form, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net Vilon content or proof of correct sequence direction and stereochemistry. Molecular identity should be assessed using the applicable combination of chromatographic, mass-spectrometry, dipeptide-content and batch-manufacturing documentation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility, complete molecular identity, sequence direction, stereochemical integrity or the absence of every dipeptide-related and process-related impurity. Any sterility claim must be supported separately by an appropriate validated sterility test and controlled production documentation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, impurity profiling, reference-material evaluation and general laboratory work, the\n \u003cstrong\u003eRegular Vilon specification remains highly suitable\u003c\/strong\u003e.\n The premium black-and-gold ULTIMATE Vilon option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for projects requiring enhanced quality-control parameters.\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP060.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP060.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"5mg","offer_id":50022731776338,"sku":"PEP060","price":14.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022731809106,"sku":"PEP060","price":26.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022731841874,"sku":"PEP060","price":47.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022731874642,"sku":"PEP060","price":108.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51257739215186,"sku":"PEP060","price":57.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51257745310034,"sku":"PEP060","price":113.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51257749700946,"sku":"PEP060","price":105.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51257751961938,"sku":"PEP060","price":210.85,"currency_code":"GBP","in_stock":true},{"title":"5mg Ultimate","offer_id":54670776205650,"sku":"PEP060U","price":22.85,"currency_code":"GBP","in_stock":true},{"title":"10mg Ultimate","offer_id":54670790099282,"sku":"PEP060U","price":38.5,"currency_code":"GBP","in_stock":true},{"title":"20mg Ultimate","offer_id":54670814052690,"sku":"PEP060U","price":62.85,"currency_code":"GBP","in_stock":true},{"title":"50mg Ultimate","offer_id":54670849343826,"sku":"PEP060U","price":149.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54766528528722,"sku":"PEP060U","price":82.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54766528561490,"sku":"PEP060U","price":164.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54766528594258,"sku":"PEP060U","price":153.5,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766528627026,"sku":"PEP060U","price":305.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-vilon-research-peptide-pure-fine-powder.png?v=1767865800"},{"product_id":"vip-research-peptide","title":"VIP (Vasoactive Intestinal Peptide) - Research Grade Peptide","description":"\u003ch3 id=\"vip-vasoactive-intestinal-peptide-research-grade-peptide\"\u003e\n \u003cstrong\u003e\n VIP (Vasoactive Intestinal Peptide)\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, Helvetica, sans-serif;\"\u003e\n – Research-Grade 28-Residue Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n Research-grade, sequence-defined Vasoactive Intestinal Peptide with batch documentation available where supplied\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Defined linear peptide sequence comprising 28 amino-acid residues\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n C-terminally amidated structure corresponding to mature human VIP and aviptadil\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Batch identity, chromatographic purity, molecular mass, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n VIP, also known as Vasoactive Intestinal Peptide, Vasoactive Intestinal Polypeptide or aviptadil, is a sequence-defined linear peptide comprising 28 amino-acid residues and a C-terminal asparaginamide. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage, analytical method development and peptide characterisation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n The stated nominal amount refers to the declared VIP or aviptadil peptide content of a single vial, subject to the applicable batch documentation and stated assay basis. Total vial mass may additionally include residual water, counter-ions or declared formulation components, which should be identified separately in the applicable Certificate of Analysis.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Where laboratory dissolution or reconstitution is required, the solvent, buffer, concentration, mixing procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal bacteriostatic-water instruction should not be applied to every VIP chemical form or laboratory preparation. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT VIP MOLECULAR IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 20px 22px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 9px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.5px;\n text-transform: uppercase;\n \"\u003e\n Important Molecular Identity Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n This PEP061 listing describes the mature, C-terminally amidated VIP structure:\n \u003cstrong\u003e\n H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/strong\u003e.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n The C-terminal asparaginamide is an integral part of the molecular identity. A related structure ending in a free asparagine carboxylic acid,\n \u003cstrong\u003eAsn-OH\u003c\/strong\u003e,\n has a different elemental formula and molecular weight and should not be represented using the amidated VIP specification.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n The applicable Certificate of Analysis should confirm the complete 28-residue sequence, C-terminal amidation, molecular formula, measured molecular mass, chromatographic purity, net peptide content and any acetate, trifluoroacetate or other counter-ion present in the supplied batch.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT VIP MOLECULAR IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-vip-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 34px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px 28px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 24%,\n #202020 54%,\n #101010 78%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 22px 50px rgba(0, 0, 0, 0.38),\n 0 0 0 1px rgba(212, 175, 55, 0.09),\n inset 0 1px 0 rgba(255, 239, 170, 0.09),\n inset 0 0 36px rgba(212, 175, 55, 0.04);\n \"\u003e\n \u003c!-- DECORATIVE UPPER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -145px;\n right: -105px;\n width: 380px;\n height: 380px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 31%,\n rgba(212, 175, 55, 0.03) 53%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE LOWER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -175px;\n left: -125px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.16) 0%,\n rgba(212, 175, 55, 0.05) 41%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE GOLD TOP EDGE --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.15),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-vip-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.24),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n VIP\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 9px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.8px;\n text-transform: uppercase;\n \"\u003e\n Additional Preparative HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 12px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.7;\n letter-spacing: 0.1px;\n \"\u003e\n A premium laboratory specification incorporating an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for demanding analytical research workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 26px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE VIP range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and batch quality control. Following the standard synthesis, C-terminal amidation and purification process, the finished VIP research material undergoes an additional preparative high-performance liquid chromatography purification stage intended to reduce further the level of chromatographically separable peptide-related, synthesis-related and process-related impurities.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n ULTIMATE batches are also assessed under a more stringent bacterial endotoxin or lipopolysaccharide testing specification. The applicable analytical method, reporting units, method-suitability controls, acceptance criterion and batch result should be stated in the corresponding Certificate of Analysis where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 28px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard VIP synthesis and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin or lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM IDENTITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.98),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.64;\n \"\u003e\n Intended for analytical projects requiring additional purification and batch-specific documentation covering sequence identity, terminal amidation, molecular mass and impurity control.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 20px 22px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.06),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.13);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.74;\n \"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, reference-material evaluation, peptide characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade VIP product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin or lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.64;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE VIP remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Molecular identity, complete sequence, terminal amidation, chromatographic purity, net peptide content, molecular form, counter-ion content, residual solvents, water content, methionine oxidation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"vip-aviptadil-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eCatalogue Product Name:\u003c\/strong\u003e\n VIP (Vasoactive Intestinal Peptide)\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Aviptadil\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n VIP; Vasoactive Intestinal Peptide; Vasoactive Intestinal Polypeptide; human VIP; Vasoactive Intestinal Octacosapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic sequence-defined linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 28 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Modified Peptide Sequence:\u003c\/strong\u003e\n H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence-Based Description:\u003c\/strong\u003e\n L-histidyl-L-seryl-L-aspartyl-L-alanyl-L-valyl-L-phenylalanyl-L-threonyl-L-aspartyl-L-asparaginyl-L-tyrosyl-L-threonyl-L-arginyl-L-leucyl-L-arginyl-L-lysyl-L-glutaminyl-L-methionyl-L-alanyl-L-valyl-L-lysyl-L-lysyl-L-tyrosyl-L-leucyl-L-asparaginyl-L-seryl-L-isoleucyl-L-leucyl-L-asparaginamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free L-histidine amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal L-asparaginamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Peptide:\u003c\/strong\u003e\n Linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None; the VIP sequence contains no cysteine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMethionine Content:\u003c\/strong\u003e\n One methionine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSulphur Content:\u003c\/strong\u003e\n The single sulphur atom in the molecular formula is contributed by the methionine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 40077-57-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n A67JUW790C\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eHuman Precursor Reference:\u003c\/strong\u003e\n UniProt accession P01282\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e147\u003c\/sub\u003eH\u003csub\u003e238\u003c\/sub\u003eN\u003csub\u003e44\u003c\/sub\u003eO\u003csub\u003e42\u003c\/sub\u003eS\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 3325.80 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eApproximate Molecular Size:\u003c\/strong\u003e\n 3.33 kDa\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the mature, uncountered, C-terminally amidated VIP or aviptadil peptide without additional acetate, trifluoroacetate, residual water, solvents or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFree-Acid Variant Distinction:\u003c\/strong\u003e\n A related structure ending in Asn-OH rather than Asn-NH\u003csub\u003e2\u003c\/sub\u003e has a different elemental formula and molecular weight and should not be represented using the amidated VIP specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAviptadil Acetate Distinction:\u003c\/strong\u003e\n Aviptadil acetate is recorded as a separate supplied chemical form and its acetate content should be identified independently in the applicable batch documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic purity represents the relative chromatographic composition measured under the stated analytical conditions and should not automatically be interpreted as equivalent to molecular identity or total net VIP peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net VIP or aviptadil content should be distinguished from chromatographic purity and interpreted alongside counter-ion content, water content, residual solvents and formulation components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as anhydrous VIP peptide equivalent or as total supplied salt-form or formulated lyophilised material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The complete 28-residue amino-acid sequence should be confirmed using the applicable supplier, synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Amidation Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the C-terminal asparaginamide and distinguish it from a free asparagine carboxylic acid terminal structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the specified C-terminally amidated VIP structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is the uncountered parent peptide, an acetate-containing form, a trifluoroacetate-containing form or another counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect the total supplied material mass, formula-weight basis and calculated net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water and hydration state may contribute to the total material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage, purification, concentration and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMethionine-Oxidation Control:\u003c\/strong\u003e\n Oxidation of the methionine residue is a distinct peptide-related quality attribute and should be assessed or controlled where required by the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely amidated material, methionine oxidation products, incompletely deprotected sequences and other synthesis-related or process-related substances are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, buffer, concentration and mixing procedure should be selected using the applicable batch documentation and validated laboratory method; a universal bacteriostatic-water instruction should not be applied to every VIP preparation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, complete sequence, terminal amidation, chromatographic purity, net peptide content, methionine oxidation, water content, residual solvents, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n ✓ \u003cstrong\u003eBatch documentation\u003c\/strong\u003e – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eCertificate of Analysis\u003c\/strong\u003e – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSafety Data Sheet\u003c\/strong\u003e – Supplied to support appropriate laboratory handling, storage and regulatory compliance where available.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSequence documentation\u003c\/strong\u003e – The complete 28-residue amino-acid sequence should be confirmed using the applicable synthesis and batch records.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eC-terminal modification documentation\u003c\/strong\u003e – C-terminal asparaginamide should be confirmed and distinguished from the corresponding free-acid structure.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eMass-spectrometry documentation\u003c\/strong\u003e – Molecular identity should be supported by analytical mass data consistent with the specified C-terminally amidated VIP structure.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003ePurity documentation\u003c\/strong\u003e – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003ePeptide-content documentation\u003c\/strong\u003e – Net VIP content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eChemical-form documentation\u003c\/strong\u003e – The parent peptide, acetate-containing, trifluoroacetate-containing or another counter-ion presentation should be identified clearly.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eOxidation-control documentation\u003c\/strong\u003e – Methionine oxidation should be assessed or controlled where required by the applicable research specification.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eBacterial endotoxin documentation\u003c\/strong\u003e – The applicable bacterial endotoxin or lipopolysaccharide result should identify the analytical method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSupplier documentation\u003c\/strong\u003e – Reviewed where supporting synthesis, terminal amidation, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eTrackable laboratory delivery\u003c\/strong\u003e – Securely packaged and dispatched using transport controls appropriate to the applicable batch stability and storage specification.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp style=\"color: #c00000; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor Research Use Only\u003c\/strong\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"vip-aviptadil-product-overview\"\u003e\n \u003cstrong\u003eVIP and Aviptadil Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Our\n \u003cstrong\u003eresearch-grade VIP and aviptadil laboratory material\u003c\/strong\u003e\n is supplied for controlled analytical method development, peptide identity assessment, high-performance liquid chromatography evaluation, liquid chromatography–mass spectrometry workflows, impurity profiling, reference-material comparison and other scientific laboratory investigations.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The mature VIP molecule comprises a defined linear sequence of 28 amino-acid residues with a free N-terminal histidine and a C-terminal asparaginamide. The complete sequence is HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH\u003csub\u003e2\u003c\/sub\u003e. The molecule contains no cysteine residues and therefore has no intramolecular disulphide bonds.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The CAS number 40077-57-4, molecular formula C\u003csub\u003e147\u003c\/sub\u003eH\u003csub\u003e238\u003c\/sub\u003eN\u003csub\u003e44\u003c\/sub\u003eO\u003csub\u003e42\u003c\/sub\u003eS and average molecular weight of approximately 3325.80 g\/mol describe the mature, uncountered and C-terminally amidated VIP molecule. Where the supplied laboratory material contains acetate, trifluoroacetate, residual water, solvents or formulation ingredients, the applicable batch documentation should identify their contribution to the total supplied material mass.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Product identity should not be assigned from the product name or CAS number alone. The complete sequence, C-terminal amidation and mass-spectrometry result should agree with the specified molecular structure. A related free-acid form ending Asn-OH would have a different molecular formula and mass.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, complete amino-acid sequence, terminal amidation, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, methionine oxidation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net VIP content or proof of correct sequence and terminal amidation. Molecular identity should be assessed using the applicable combination of chromatographic, mass-spectrometry, peptide-content and batch-manufacturing documentation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility, complete molecular identity, correct terminal amidation, methionine oxidation status or the absence of every peptide-related and process-related impurity. Any sterility claim must be supported separately by an appropriate validated sterility test and controlled production documentation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, impurity profiling, peptide characterisation and general laboratory work, the\n \u003cstrong\u003eRegular VIP specification remains highly suitable\u003c\/strong\u003e.\n The premium black-and-gold ULTIMATE VIP option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for projects requiring enhanced quality-control parameters.\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP061.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP061.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"5mg","offer_id":50022751404370,"sku":"PEP061","price":92.25,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50022751437138,"sku":"PEP061","price":172.25,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50022751469906,"sku":"PEP061","price":307.15,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50022751502674,"sku":"PEP061","price":735.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51257760055634,"sku":"PEP061","price":368.15,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51257761104210,"sku":"PEP061","price":765.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51257764249938,"sku":"PEP061","price":714.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51257767952722,"sku":"PEP061","price":1428.5,"currency_code":"GBP","in_stock":true},{"title":"5mg Ultimate","offer_id":54670673772882,"sku":"PEP061U","price":135.25,"currency_code":"GBP","in_stock":true},{"title":"10mg Ultimate","offer_id":54670696317266,"sku":"PEP061U","price":230.5,"currency_code":"GBP","in_stock":true},{"title":"20mg Ultimate","offer_id":54670722728274,"sku":"PEP061U","price":383.95,"currency_code":"GBP","in_stock":true},{"title":"50mg Ultimate","offer_id":54670743142738,"sku":"PEP061U","price":920.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54766528364882,"sku":"PEP061U","price":555.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54766528397650,"sku":"PEP061U","price":1110.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54766528430418,"sku":"PEP061U","price":1036.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766528463186,"sku":"PEP061U","price":2071.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-vip-research-peptide-pure-fine-powder.png?v=1767865800"},{"product_id":"nad-supplement-uk-research-grade-peptide","title":"NAD+ - Research Grade Peptide","description":"\u003ch3 id=\"nad-plus-research-grade-oxidised-dinucleotide-coenzyme\"\u003e\n \u003cstrong\u003e\n NAD+\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Oxidised Dinucleotide Coenzyme\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade oxidised nicotinamide adenine dinucleotide with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined dinucleotide coenzyme supplied in the NAD+ oxidised molecular form\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as measured lyophilised or dry laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, assay, chromatographic purity, water content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory biochemical\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n NAD+, also known as oxidised nicotinamide adenine dinucleotide, beta-NAD or nadide, is a dinucleotide coenzyme rather than a peptide. Each vial contains measured laboratory material prepared to support controlled scientific handling, storage and analytical investigation. The stated nominal amount refers to the declared NAD+ content of a single vial, subject to the applicable batch documentation. Where dissolution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT NAD+ IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 19px 21px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 8px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.4px;\n text-transform: uppercase;\n \"\u003e\n Important Chemical Identity Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n This product is\n \u003cstrong\u003eoxidised nicotinamide adenine dinucleotide, NAD+\u003c\/strong\u003e.\n It is a nucleotide-derived biochemical coenzyme and is not a peptide, protein or amino-acid sequence.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n NAD+, reduced NADH, phosphorylated NADP+, sodium salts, hydrates and other chemical forms are distinct materials. The exact oxidation state, anomeric form, salt form, hydration state, assay basis and molecular-weight convention should agree with the applicable batch Certificate of Analysis.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT NAD+ IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-nad-plus-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-nad-plus-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n NAD+\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced High-Performance Liquid Chromatography Purification and More Stringent Endotoxin Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding biochemical, analytical and laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE NAD+ range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of dinucleotide purification and quality control. Following the standard production and purification process, the finished NAD+ research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual nucleotide-related, structurally related, degradation-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional Chromatographic Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard NAD+ production and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent Endotoxin Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM QUALITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional dinucleotide purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine biochemical assays, analytical method development, enzymology, reference-material comparison and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade NAD+ product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of biochemical quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE NAD+ remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, oxidation state, anomeric form, chromatographic purity, assay, water content, salt form, residual solvents, degradation products, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"nad-plus-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n NAD+\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Technical Name:\u003c\/strong\u003e\n Beta-nicotinamide adenine dinucleotide, oxidised form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Nicotinamide adenine dinucleotide; beta-NAD+; beta-NAD; beta-DPN; diphosphopyridine nucleotide; coenzyme I; cozymase; nadide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Oxidised dinucleotide coenzyme and pyridinium nucleotide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide Status:\u003c\/strong\u003e\n NAD+ is not a peptide and does not contain an amino-acid sequence\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStructural Description:\u003c\/strong\u003e\n An adenine ribonucleotide and a nicotinamide ribonucleotide joined through a diphosphate or pyrophosphate linkage\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOxidation State:\u003c\/strong\u003e\n Oxidised NAD+ form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnomeric Form:\u003c\/strong\u003e\n Beta form where confirmed by the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Registry Number:\u003c\/strong\u003e\n 53-84-9\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Name:\u003c\/strong\u003e\n NAD\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 5893\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChEBI Identifier:\u003c\/strong\u003e\n CHEBI:15846\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEuropean Community Number:\u003c\/strong\u003e\n 200-184-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCommon Anhydrous Free-Acid Formula:\u003c\/strong\u003e\n C\u003csub\u003e21\u003c\/sub\u003eH\u003csub\u003e27\u003c\/sub\u003eN\u003csub\u003e7\u003c\/sub\u003eO\u003csub\u003e14\u003c\/sub\u003eP\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight on an Anhydrous Free-Acid Basis:\u003c\/strong\u003e\n Approximately 663.43 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormal NAD+ Cation Representation:\u003c\/strong\u003e\n C\u003csub\u003e21\u003c\/sub\u003eH\u003csub\u003e28\u003c\/sub\u003eN\u003csub\u003e7\u003c\/sub\u003eO\u003csub\u003e14\u003c\/sub\u003eP\u003csub\u003e2\u003c\/sub\u003e\u003csup\u003e+\u003c\/sup\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight of the Formal Protonated Cation Representation:\u003c\/strong\u003e\n Approximately 664.44 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Representation Note:\u003c\/strong\u003e\n Chemical databases may display NAD+ using different protonation and formal-charge conventions. The common 663.43 g\/mol catalogue value describes the anhydrous free-acid empirical formula, while formally protonated ionic representations may differ by one hydrogen atom and approximately one mass unit\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSystematic Name:\u003c\/strong\u003e\n Adenosine 5′-{3-[1-(3-carbamoylpyridinio)-1,4-anhydro-D-ribitol-5-yl] dihydrogen diphosphate}\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Solid lyophilised or dry laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material, subject to confirmation in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAssay Specification:\u003c\/strong\u003e\n The applicable NAD+ assay result, analytical method, calculation basis and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChromatographic Purity:\u003c\/strong\u003e\n The applicable high-performance liquid chromatography purity result and method should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOxidised-Form Purity:\u003c\/strong\u003e\n The proportion of oxidised NAD+ should be distinguished from total material assay and from the presence of reduced NADH or other nucleotide-related impurities\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReduced-Form Distinction:\u003c\/strong\u003e\n NADH is the reduced form of nicotinamide adenine dinucleotide and is a separate molecular species with different oxidation state, analytical characteristics and molecular identity\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNADP+ Distinction:\u003c\/strong\u003e\n Nicotinamide adenine dinucleotide phosphate contains an additional phosphate group and should not be represented using the NAD+ formula or CAS number\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSalt-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is the free-acid form, a sodium salt, another counter-ion form or a formulated preparation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eHydration-State Confirmation:\u003c\/strong\u003e\n Residual water and hydrate content may affect the total material mass and assay on an as-is basis and should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The product specification should state whether the declared vial amount is calculated as anhydrous NAD+ equivalent or as total supplied material including residual water, salt-form components or excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity and Assay Interpretation:\u003c\/strong\u003e\n Chromatographic purity, oxidation-state purity, assay, water content, salt content and total vial mass are separate measurements and should not be treated as interchangeable\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Substance Control:\u003c\/strong\u003e\n Reduced NADH, nicotinamide, adenine-containing nucleotides, hydrolysis products, nucleotide fragments and other structurally related or process-related substances should be controlled as appropriate to the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from production, extraction, chromatography, concentration or lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, oxidation state, anomeric form, chromatographic purity, assay, salt form, hydration state, water content, residual solvents, related substances and bacterial endotoxin results are separate quality attributes and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Chemical-identity documentation – The CAS number, molecular formula, oxidation state and beta-anomeric form should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✓ Chromatographic documentation – The reported high-performance liquid chromatography purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Assay documentation – NAD+ assay should be distinguished from chromatographic purity and interpreted alongside water, salt-form and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Oxidation-state documentation – Oxidised NAD+ should be distinguished analytically from reduced NADH and other related nucleotide substances.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The free-acid form, sodium salt, hydrate or another supplied form should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Water-content documentation – Residual water and hydration state should be stated or controlled where they contribute to the total material mass.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or lipopolysaccharide result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting production, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"nad-plus-product-overview\"\u003e\n \u003cstrong\u003eNAD+ Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eNAD+ research-grade oxidised dinucleotide coenzyme\u003c\/strong\u003e,\n also known as beta-nicotinamide adenine dinucleotide, beta-NAD or nadide, is supplied for controlled scientific laboratory investigation, biochemical assay development, analytical method development, high-performance liquid chromatography assessment, mass-spectrometry workflows, enzymology and reference-material comparison.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n NAD+ comprises nicotinamide and adenine ribonucleotide components joined through a diphosphate linkage. It is the oxidised member of the NAD+\/NADH redox pair and should not be confused with reduced NADH, phosphorylated NADP+, nicotinamide riboside, nicotinamide mononucleotide or other structurally related biochemical materials.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, oxidation state, anomeric form, chromatographic purity, assay, salt form, hydration state, water content, residual solvents, related substances, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 53-84-9, molecular formula C\u003csub\u003e21\u003c\/sub\u003eH\u003csub\u003e27\u003c\/sub\u003eN\u003csub\u003e7\u003c\/sub\u003eO\u003csub\u003e14\u003c\/sub\u003eP\u003csub\u003e2\u003c\/sub\u003e and average molecular weight of approximately 663.43 g\/mol describe the commonly used anhydrous free-acid empirical representation. Formal ionic representations may show a different hydrogen count and molecular weight according to the protonation and charge convention applied.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to the total NAD+ assay or the net anhydrous NAD+ content of the vial. Likewise, a bacterial endotoxin or lipopolysaccharide result does not establish sterility, oxidation-state purity, molecular identity, anomeric identity or the absence of every nucleotide-related and process-related impurity.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine biochemical assays, analytical method development, enzymology, reference-material comparison and general laboratory work, the Regular NAD+ specification remains highly suitable. The premium black-and-gold ULTIMATE NAD+ option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP042.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP042.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50023073022290,"sku":"PEP042","price":14.25,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50023073055058,"sku":"PEP042","price":32.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50023073087826,"sku":"PEP042","price":60.85,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50023073120594,"sku":"PEP042","price":111.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50023073153362,"sku":"PEP042","price":255.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51256836063570,"sku":"PEP042","price":133.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51256837210450,"sku":"PEP042","price":265.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51256839635282,"sku":"PEP042","price":248.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51256841797970,"sku":"PEP042","price":496.25,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54656966918482,"sku":"PEP042U","price":47.95,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54656966951250,"sku":"PEP042U","price":87.5,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54656966984018,"sku":"PEP042U","price":161.25,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54656967016786,"sku":"PEP042U","price":370.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54656967049554,"sku":"PEP042U","price":193.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54656967082322,"sku":"PEP042U","price":385.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 8 - Ultimate","offer_id":54656967115090,"sku":"PEP042U","price":360.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54656967147858,"sku":"PEP042U","price":719.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-nad-supplement-uk-pure-fine-peptide-powder.png?v=1767865800"},{"product_id":"pure-acetic-acid-uk-research-use","title":"ACETIC ACID - Research Use Only","description":"\u003cdiv class=\"research-scientific-product-description\" lang=\"en-GB\" style=\"box-sizing: border-box; width: 100%; max-width: 100%; min-width: 0; font-family: Arial, Helvetica, sans-serif; font-size: 15px; line-height: 1.7; color: #222222; text-align: left; overflow-wrap: anywhere;\"\u003e\n\n \u003ch3 id=\"acetic-acid-research-grade\" style=\"margin: 0 0 18px; color: #00455f; font-size: 20px; line-height: 1.35;\"\u003e\n ACETIC ACID – Research Grade Laboratory Reagent\n \u003c\/h3\u003e\n\n \u003cdiv role=\"note\" aria-labelledby=\"research-only-acetic-acid\" style=\"box-sizing: border-box; margin: 0 0 22px; padding: 18px 20px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; border-radius: 12px; font-size: 15px; line-height: 1.7;\"\u003e\n \u003ch4 id=\"research-only-acetic-acid\" style=\"margin: 0 0 10px; color: #c00000; font-size: 16px; line-height: 1.45;\"\u003e\n For research purposes only\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n This product is supplied exclusively for scientific laboratory research and\n analytical purposes. It is not intended for human or animal use, consumption,\n clinical use or therapeutic application.\n \u003c\/p\u003e\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n It must not be used in any way that contravenes applicable laws or the\n requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n \u003cp style=\"margin: 0;\"\u003e\n \u003cstrong\u003eThese restrictions apply to every grade of this product.\u003c\/strong\u003e\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cul style=\"margin: 0 0 20px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eResearch-grade acetic acid supplied exclusively for laboratory and analytical work.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003ePresented in flip-top headspace vials designed for laboratory use.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eBatch documentation available where supplied.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n Research Scientific supplies acetic acid, also known as ethanoic acid, as a\n laboratory reagent. Review the product label, manufacturer's specification\n and available batch records when selecting material for your analytical procedure.\n \u003c\/p\u003e\n\n \u003cdiv role=\"note\" aria-labelledby=\"acetic-acid-concentration-notice\" style=\"box-sizing: border-box; margin: 0 0 24px; padding: 18px 20px; color: #00455f; background-color: #f2f7f9; border: 1px solid #d5e4ea; border-left: 4px solid #00455f; border-radius: 12px;\"\u003e\n \u003ch4 id=\"acetic-acid-concentration-notice\" style=\"margin: 0 0 10px; color: #00455f; font-size: 16px; line-height: 1.45;\"\u003e\n Important: Pure Acetic Acid – Not Premixed\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0;\"\u003e\n The supplied product description specifies \u003cstrong\u003epure acetic acid, not a\n premixed or prediluted solution\u003c\/strong\u003e. No numerical purity or concentration\n is stated. Confirm the assay and composition in the completed batch documentation;\n do not interpret the word “pure” as a verified 100% purity result.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003csection aria-labelledby=\"acetic-acid-chemical-information\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"acetic-acid-chemical-information\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Chemical Information\n \u003c\/h3\u003e\n\n \u003cul style=\"margin: 0 0 18px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eProduct name:\u003c\/strong\u003e Acetic acid.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eSystematic chemical name:\u003c\/strong\u003e Ethanoic acid.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eChemical Abstracts Service registry number:\u003c\/strong\u003e 64-19-7.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eMolecular formula:\u003c\/strong\u003e\n C\u003csub\u003e2\u003c\/sub\u003eH\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e2\u003c\/sub\u003e.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eMolar mass:\u003c\/strong\u003e 60.05 grams per mole.\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n These chemical identifiers and the molar mass are retained from the supplied\n description. They identify the named substance but do not establish the purity,\n water content or analytical specification of the supplied batch.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n \u003c!--\n Product-specific publication checks:\n The supplied chemical name, registry number, formula and numerical molar mass\n are retained without substituting a different identity or batch specification.\n The statement \"pure Acetic Acid, not pre mixed\" is retained with clarification:\n no percentage assay, water-content result or concentration has been supplied.\n\n The source describes the vials, not the acetic acid contents, as sterile.\n No lyophilised powder, peptide formulation, reconstitution solvent, numerical\n purity, manufacturing location or fixed storage temperature has been inferred.\n\n No ULTIMATE acetic acid grade, purification process or endotoxin result is\n established by the supplied product description. The following panel retains\n the established range styling and clearly identifies this limitation.\n --\u003e\n\n \u003csection class=\"ultimate-research-grade\" aria-labelledby=\"ultimate-acetic-acid-heading\" style=\"box-sizing: border-box; width: 100%; margin: 32px 0; font-family: Arial, Helvetica, sans-serif;\"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 28px;\n background-color: #080808;\n background-image: linear-gradient(135deg, #020202 0%, #090909 25%, #1c1c1c 56%, #101010 77%, #030303 100%);\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow: 0 16px 36px rgba(0, 0, 0, 0.25), inset 0 1px 0 rgba(255, 239, 170, 0.08);\n \"\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n pointer-events: none;\n background: radial-gradient(circle, rgba(255, 230, 139, 0.22) 0%, rgba(212, 175, 55, 0.08) 35%, rgba(212, 175, 55, 0) 73%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background: linear-gradient(90deg, transparent 0%, #d4af37 24%, #ffeea9 50%, #d4af37 76%, transparent 100%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n\n \u003cdiv style=\"\n display: inline-block;\n box-sizing: border-box;\n max-width: 100%;\n margin: 0 0 18px;\n padding: 8px 14px;\n color: #f7df88;\n background-color: rgba(212, 175, 55, 0.09);\n border: 1px solid rgba(247, 223, 136, 0.65);\n border-radius: 999px;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.6px;\n \"\u003e\n Premium Laboratory Range Information\n \u003c\/div\u003e\n\n \u003ch3 id=\"ultimate-acetic-acid-heading\" style=\"margin: 0; color: #ffffff; font-size: 26px; font-weight: 700; line-height: 1.25;\"\u003e\n \u003cspan style=\"color: #f4d978; text-shadow: 0 0 18px rgba(212, 175, 55, 0.23);\"\u003eULTIMATE\u003c\/span\u003e\n \u003cspan style=\"display: inline-block; max-width: 100%; color: #ffffff;\"\u003eSpecification\u003c\/span\u003e\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 10px 0 0; color: #f0d77d; font-size: 15px; font-weight: 700; line-height: 1.6; letter-spacing: 0.5px;\"\u003e\n Acetic acid grade availability requires confirmation\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"height: 1px; margin: 24px 0; background: linear-gradient(90deg, transparent, #d4af37, #f7df88, #d4af37, transparent);\"\u003e\u003c\/div\u003e\n\n \u003cp style=\"margin: 0; color: #f1f1f1; font-size: 15px; line-height: 1.8;\"\u003e\n The \u003cstrong style=\"color: #f7df88;\"\u003eULTIMATE range\u003c\/strong\u003e concerns additional\n preparative high-performance liquid chromatography purification and more\n stringent bacterial endotoxin testing. These processes are\n \u003cstrong style=\"color: #ffffff;\"\u003enot established for this acetic acid listing\u003c\/strong\u003e.\n Contact Research Scientific to confirm whether a product-specific ULTIMATE\n option is available and to obtain its documented specification.\n \u003c\/p\u003e\n\n \u003cdiv style=\"display: flex; flex-wrap: wrap; gap: 14px; margin: 26px 0;\"\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Purification Specification\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n Any additional purification process must be supported by manufacturing\n records specifically applicable to the acetic acid supplied.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Endotoxin Specification\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n No endotoxin test method, result or acceptance limit is provided in the\n supplied product information. Request supporting records where required.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Batch-Specific Documentation\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n Review the assay, composition and available analytical results for the\n exact product, grade and batch under consideration.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003c\/div\u003e\n\n \u003cdiv style=\"padding: 18px 20px; background-color: rgba(212, 175, 55, 0.05); border: 1px solid rgba(255, 255, 255, 0.08); border-left: 4px solid #d4af37; border-radius: 8px;\"\u003e\n \u003ch4 style=\"margin: 0 0 8px; color: #f7df88; font-size: 15px; line-height: 1.4;\"\u003e\n Regular or ULTIMATE?\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #e5e5e5; font-size: 15px; line-height: 1.75;\"\u003e\n \u003cstrong style=\"color: #ffffff;\"\u003eThe Regular research-grade product is appropriate for routine laboratory work\u003c\/strong\u003e\n where its documented specification meets the requirements of your method.\n Consider ULTIMATE only where its availability and additional product-specific\n specification have been confirmed.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"margin: 20px 0 0; color: #cccccc; font-size: 14px; line-height: 1.7;\"\u003e\n \u003cstrong style=\"color: #f7df88;\"\u003eSpecification note:\u003c\/strong\u003e\n A grade designation alone does not establish numerical purity, analytical\n performance or sterility.\n \u003c\/p\u003e\n\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"acetic-acid-presentation-handling\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"acetic-acid-presentation-handling\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Laboratory Presentation and Safe Handling\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eVial specification:\u003c\/strong\u003e\n The supplied description identifies the flip-top headspace vials as sterile.\n Confirm the relevant packaging records where sterility is required; the vial\n description does not establish that the acetic acid contents are sterile.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eGeneral safety reference:\u003c\/strong\u003e\n The International Chemical Safety Card for glacial acetic acid identifies\n flammability and corrosive hazards, including severe skin burns and eye damage.\n This general reference is not a substitute for the Safety Data Sheet for the\n exact material supplied.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n Handle under an appropriate laboratory risk assessment, with suitable ventilation,\n protective gloves, protective clothing and eye protection. Keep away from ignition\n sources and incompatible materials. Any laboratory dilution must follow an\n appropriate, validated procedure.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n \u003ca href=\"https:\/\/www.inchem.org\/documents\/icsc\/icsc\/eics0363.htm\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n General safety reference: International Chemical Safety Card 0363\n \u003c\/a\u003e\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"acetic-acid-documentation-delivery\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"acetic-acid-documentation-delivery\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Product Documentation and Delivery\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eBatch and supplier records:\u003c\/strong\u003e\n Supporting supplier documentation is reviewed where supplied. Scan the code\n on the packaging, where provided, or contact Research Scientific for the\n records available for the selected batch.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP104.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n View Certificate of Analysis template\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n The linked certificate displayed an uncompleted template when checked on\n 10 September 2026. Request a completed acetic acid Certificate of Analysis\n identifying the product, batch, assay and reported analytical results.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP104.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n Acetic Acid Safety Data Sheet – Supplied Document Link\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n This document address was unavailable when checked on 10 September 2026.\n Request the current, product-specific Safety Data Sheet from Research Scientific\n before handling the material, including its storage, disposal and transport information.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n \u003cstrong\u003eTracked delivery:\u003c\/strong\u003e\n The supplied listing specifies secure packaging and frozen dispatch in insulated\n packaging using a tracked delivery service. Confirm the dispatch temperature,\n packaging and carrier arrangements applicable to this acetic acid product\n before shipment.\n \u003c\/p\u003e\n\n \u003c!--\n Document review: 10 September 2026.\n Both product-specific addresses from the source are retained unchanged.\n The PEP104 Certificate of Analysis displayed an uncompleted template with\n no populated product identity, batch number or analytical results.\n The supplied PEP104 Safety Data Sheet address returned HTTP 404 when checked;\n its contents could not be reviewed. No replacement address has been invented.\n Update the visible status notes after the documents are completed or restored.\n\n The original frozen-dispatch and insulated-packaging statement is retained\n as supplied, with a product-specific transport confirmation requirement.\n It has not been converted into a general storage or cold-chain recommendation.\n\n External general safety reference, distinct from the supplied specification:\n https:\/\/www.inchem.org\/documents\/icsc\/icsc\/eics0363.htm\n This reference does not verify this product's concentration, assay or batch.\n --\u003e\n \u003c\/section\u003e\n\n\u003c\/div\u003e","brand":"peptidestore","offers":[{"title":"2ml","offer_id":50056236171602,"sku":"PEP104","price":5.5,"currency_code":"GBP","in_stock":true},{"title":"5ml","offer_id":50056236204370,"sku":"PEP104","price":7.85,"currency_code":"GBP","in_stock":true},{"title":"10ml","offer_id":50056236237138,"sku":"PEP104","price":12.95,"currency_code":"GBP","in_stock":true},{"title":"20ml","offer_id":50056236269906,"sku":"PEP104","price":18.25,"currency_code":"GBP","in_stock":true},{"title":"50ml","offer_id":50056236302674,"sku":"PEP104","price":32.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5ml Lab Pack 1","offer_id":51241966272850,"sku":"PEP104","price":28.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5ml Lab Pack 2","offer_id":51241967419730,"sku":"PEP104","price":50.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10ml Lab Pack 3","offer_id":51241968992594,"sku":"PEP104","price":100.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10ml Lab Pack 4","offer_id":51241971253586,"sku":"PEP104","price":100.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-pure-acetic-acid-uk-ultra-pure-research-grade.png?v=1767865802"},{"product_id":"bacteriostatic-water-for-research","title":"BACTERIOSTATIC MIXING WATER - Research Grade","description":"\u003cdiv class=\"research-scientific-product-description\" lang=\"en-GB\" style=\"box-sizing: border-box; width: 100%; max-width: 100%; min-width: 0; font-family: Arial, Helvetica, sans-serif; font-size: 15px; line-height: 1.7; color: #222222; text-align: left; overflow-wrap: anywhere;\"\u003e\n\n \u003ch3 id=\"bacteriostatic-mixing-water-research-grade\" style=\"margin: 0 0 18px; color: #00455f; font-size: 20px; line-height: 1.35;\"\u003e\n BACTERIOSTATIC MIXING WATER – Research Grade Laboratory Solution\n \u003c\/h3\u003e\n\n \u003cdiv role=\"note\" aria-labelledby=\"research-only-bacteriostatic-mixing-water\" style=\"box-sizing: border-box; margin: 0 0 22px; padding: 18px 20px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; border-radius: 12px; font-size: 15px; line-height: 1.7;\"\u003e\n \u003ch4 id=\"research-only-bacteriostatic-mixing-water\" style=\"margin: 0 0 10px; color: #c00000; font-size: 16px; line-height: 1.45;\"\u003e\n For research purposes only\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n This product is supplied exclusively for scientific laboratory research and\n analytical purposes. It is not intended for human or animal use, consumption,\n clinical use or therapeutic application.\n \u003c\/p\u003e\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n It must not be used in any way that contravenes applicable laws or the\n requirements of the Medicines and Healthcare products Regulatory Agency.\n Research Scientific does not provide advice or recommendations concerning\n dosage, administration or use in humans or animals.\n \u003c\/p\u003e\n \u003cp style=\"margin: 0;\"\u003e\n \u003cstrong\u003eThese restrictions apply to every grade of this product.\u003c\/strong\u003e\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cul style=\"margin: 0 0 20px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eResearch-grade mixing water for scientific laboratory and analytical work.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eStated formulation: water containing 0.9% benzyl alcohol.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eSupplied in flip-top headspace vials designed for laboratory use.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n Research Scientific supplies Bacteriostatic Mixing Water as an aqueous laboratory\n solution. Review the formulation details and documentation notes below when\n assessing the product against the requirements of your laboratory procedure.\n \u003c\/p\u003e\n\n \u003csection aria-labelledby=\"bacteriostatic-mixing-water-chemical-information\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"bacteriostatic-mixing-water-chemical-information\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Chemical Information\n \u003c\/h3\u003e\n\n \u003cul style=\"margin: 0 0 18px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eProduct name:\u003c\/strong\u003e Bacteriostatic Mixing Water.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eAlternative description, as supplied:\u003c\/strong\u003e\n Sterile water with 0.9% benzyl alcohol.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003ePurity:\u003c\/strong\u003e\n Listed as not applicable in the supplied description. The stated 0.9%\n refers to solution strength, not a numerical purity result.\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003ch4 id=\"bacteriostatic-mixing-water-water-component\" style=\"margin: 20px 0 12px; color: #00455f; font-size: 16px; line-height: 1.45;\"\u003e\n Chemical Information – Water Component\n \u003c\/h4\u003e\n\n \u003cul style=\"margin: 0 0 18px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eChemical Abstracts Service registry number:\u003c\/strong\u003e 7732-18-5.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eMolecular formula of water:\u003c\/strong\u003e H\u003csub\u003e2\u003c\/sub\u003eO.\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003ch4 id=\"bacteriostatic-mixing-water-benzyl-alcohol-component\" style=\"margin: 24px 0 12px; color: #00455f; font-size: 16px; line-height: 1.45;\"\u003e\n Chemical Information – Benzyl Alcohol Component\n \u003c\/h4\u003e\n\n \u003cul style=\"margin: 0 0 18px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eChemical Abstracts Service registry number:\u003c\/strong\u003e 100-51-6.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eStated concentration in the solution:\u003c\/strong\u003e 0.9%.\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eConcentration clarification:\u003c\/strong\u003e\n The supplied description does not state whether 0.9% is expressed by mass,\n by volume or as mass per volume. Confirm the concentration basis against the\n manufacturer's formulation specification and completed batch documentation.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n The registry numbers identify the listed components, while H\u003csub\u003e2\u003c\/sub\u003eO\n describes water only, not the complete solution. The supplied formulation\n details have been retained; the conflicting Safety Data Sheet requires\n reconciliation as noted under Product Documentation below.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n \u003c!--\n Publication checks:\n The current product description supplies the two component registry numbers,\n the water formula and the stated 0.9% benzyl alcohol concentration.\n No concentration basis, percentage water content, additional ingredient,\n water-quality standard or numerical purity has been inferred.\n\n The source describes sterile water and sterile vials. These statements are\n retained as supplied specifications, not presented as verified batch results.\n Confirm supporting manufacturing and microbiological records.\n\n No product-specific ULTIMATE grade or processing record was supplied.\n The panel below describes the established range without asserting that\n additional purification or endotoxin testing applies to this solution.\n --\u003e\n\n \u003csection class=\"ultimate-research-grade\" aria-labelledby=\"ultimate-bacteriostatic-mixing-water-heading\" style=\"box-sizing: border-box; width: 100%; margin: 32px 0; font-family: Arial, Helvetica, sans-serif;\"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 28px;\n background-color: #080808;\n background-image: linear-gradient(135deg, #020202 0%, #090909 25%, #1c1c1c 56%, #101010 77%, #030303 100%);\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow: 0 16px 36px rgba(0, 0, 0, 0.25), inset 0 1px 0 rgba(255, 239, 170, 0.08);\n \"\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n pointer-events: none;\n background: radial-gradient(circle, rgba(255, 230, 139, 0.22) 0%, rgba(212, 175, 55, 0.08) 35%, rgba(212, 175, 55, 0) 73%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background: linear-gradient(90deg, transparent 0%, #d4af37 24%, #ffeea9 50%, #d4af37 76%, transparent 100%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n\n \u003cdiv style=\"\n display: inline-block;\n box-sizing: border-box;\n max-width: 100%;\n margin: 0 0 18px;\n padding: 8px 14px;\n color: #f7df88;\n background-color: rgba(212, 175, 55, 0.09);\n border: 1px solid rgba(247, 223, 136, 0.65);\n border-radius: 999px;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.6px;\n \"\u003e\n Premium Laboratory Range Information\n \u003c\/div\u003e\n\n \u003ch3 id=\"ultimate-bacteriostatic-mixing-water-heading\" style=\"margin: 0; color: #ffffff; font-size: 26px; font-weight: 700; line-height: 1.25;\"\u003e\n \u003cspan style=\"color: #f4d978; text-shadow: 0 0 18px rgba(212, 175, 55, 0.23);\"\u003eULTIMATE\u003c\/span\u003e\n \u003cspan style=\"display: inline-block; max-width: 100%; color: #ffffff;\"\u003eSpecification\u003c\/span\u003e\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 10px 0 0; color: #f0d77d; font-size: 15px; font-weight: 700; line-height: 1.6; letter-spacing: 0.5px;\"\u003e\n Bacteriostatic Mixing Water – grade availability requires confirmation\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"height: 1px; margin: 24px 0; background: linear-gradient(90deg, transparent, #d4af37, #f7df88, #d4af37, transparent);\"\u003e\u003c\/div\u003e\n\n \u003cp style=\"margin: 0; color: #f1f1f1; font-size: 15px; line-height: 1.8;\"\u003e\n The \u003cstrong style=\"color: #f7df88;\"\u003eULTIMATE range\u003c\/strong\u003e concerns additional\n preparative high-performance liquid chromatography purification and more\n stringent bacterial endotoxin testing. These processes are\n \u003cstrong style=\"color: #ffffff;\"\u003enot established for this Bacteriostatic Mixing Water listing\u003c\/strong\u003e.\n Contact Research Scientific to confirm whether a product-specific ULTIMATE\n option is available and to obtain its documented specification.\n \u003c\/p\u003e\n\n \u003cdiv style=\"display: flex; flex-wrap: wrap; gap: 14px; margin: 26px 0;\"\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Purification Specification\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n Any additional purification process must be supported by manufacturing\n records specifically applicable to the finished aqueous formulation supplied.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Endotoxin Specification\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n No endotoxin test method, result or acceptance limit is provided in the\n supplied product information. Request supporting records where required.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Batch-Specific Documentation\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n Review the benzyl alcohol concentration, formulation and available analytical\n results for the exact product, grade and batch under consideration.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003c\/div\u003e\n\n \u003cdiv style=\"padding: 18px 20px; background-color: rgba(212, 175, 55, 0.05); border: 1px solid rgba(255, 255, 255, 0.08); border-left: 4px solid #d4af37; border-radius: 8px;\"\u003e\n \u003ch4 style=\"margin: 0 0 8px; color: #f7df88; font-size: 15px; line-height: 1.4;\"\u003e\n Regular or ULTIMATE?\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #e5e5e5; font-size: 15px; line-height: 1.75;\"\u003e\n \u003cstrong style=\"color: #ffffff;\"\u003eThe Regular research-grade product is appropriate for routine laboratory work\u003c\/strong\u003e\n where its documented specification meets the requirements of your method.\n Consider ULTIMATE only where its availability and additional product-specific\n specification have been confirmed.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"margin: 20px 0 0; color: #cccccc; font-size: 14px; line-height: 1.7;\"\u003e\n \u003cstrong style=\"color: #f7df88;\"\u003eSpecification note:\u003c\/strong\u003e\n A grade designation alone does not establish numerical purity, analytical\n performance or sterility.\n \u003c\/p\u003e\n\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"bacteriostatic-mixing-water-laboratory-handling\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"bacteriostatic-mixing-water-laboratory-handling\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Laboratory Presentation and Handling\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003ePresentation and sterility:\u003c\/strong\u003e\n The supplied description identifies both the water-based solution and the\n flip-top headspace vials as sterile. Confirm the relevant manufacturing and\n batch records before relying on these claims for a laboratory procedure.\n No sterility test result is provided in the supplied description.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eLaboratory compatibility:\u003c\/strong\u003e\n Confirm that the stated water and benzyl alcohol formulation is compatible\n with the material being prepared and your laboratory's analytical method.\n Suitability should be assessed against the confirmed product specification.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n \u003cstrong\u003eHandling and storage:\u003c\/strong\u003e\n Request corrected, formulation-specific safety documentation before handling\n the product. Confirm the applicable storage conditions and any permitted\n period of use after opening with Research Scientific; these have not been\n established in the supplied product description.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"bacteriostatic-mixing-water-documentation\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"bacteriostatic-mixing-water-documentation\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Product Documentation\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eBatch and supplier records:\u003c\/strong\u003e\n Supporting supplier documentation is reviewed where supplied. Scan the code\n on the packaging, where provided, or contact Research Scientific for the\n records available for the selected product and batch.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP105.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n View Certificate of Analysis template\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n The linked certificate displayed an uncompleted template when checked on\n 10 September 2026. Request a completed certificate identifying Bacteriostatic\n Mixing Water, the batch number, formulation specification and reported\n analytical results.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP105.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n View Bacteriostatic Mixing Water Safety Data Sheet – Clarification Required\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n The linked Safety Data Sheet lists water with acetic acid and describes a\n lyophilised solid, which conflicts with the water and benzyl alcohol solution\n described here. Request a corrected document matching the confirmed composition\n and physical form before relying on it for handling, storage or disposal.\n \u003c\/p\u003e\n\n \u003c!--\n Document review: 10 September 2026.\n Both original product-specific addresses are retained unchanged.\n The Certificate of Analysis is an uncompleted template, not batch evidence.\n The Safety Data Sheet's identification and physical-properties sections\n conflict with the current product description. No acetic acid ingredient,\n lyophilised presentation or freezer-storage requirement has been adopted.\n Reconcile the formulation and catalogue reference with the manufacturer,\n replace the conflicting document, and update the visible status notes.\n --\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"bacteriostatic-mixing-water-delivery\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"bacteriostatic-mixing-water-delivery\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Tracked Delivery\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n Supplied with a tracked express delivery service. Refer to the dispatch\n information for the delivery option applicable to your order.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n\u003c\/div\u003e","brand":"peptidestore","offers":[{"title":"5ml","offer_id":50056237678930,"sku":"PEP105","price":6.95,"currency_code":"GBP","in_stock":true},{"title":"10ml","offer_id":50056237711698,"sku":"PEP105","price":10.95,"currency_code":"GBP","in_stock":true},{"title":"20ml","offer_id":50056237744466,"sku":"PEP105","price":17.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5ml Lab Pack 1","offer_id":51242133619026,"sku":"PEP105","price":25.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5ml Lab Pack 2","offer_id":51242135257426,"sku":"PEP105","price":50.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10ml Lab Pack 3","offer_id":51242136535378,"sku":"PEP105","price":45.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10ml Lab Pack 4","offer_id":51242138665298,"sku":"PEP105","price":90.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-bacteriostatic-water-for-research-sterile-0-9-benzyl-alcohol.png?v=1767865802"},{"product_id":"benzyl-alcohol-uk-supply","title":"BENZYL ALCOHOL - Research Grade Peptide","description":"\u003cdiv class=\"research-scientific-product-description\" lang=\"en-GB\" style=\"box-sizing: border-box; width: 100%; max-width: 100%; min-width: 0; font-family: Arial, Helvetica, sans-serif; font-size: 15px; line-height: 1.7; color: #222222; text-align: left; overflow-wrap: anywhere;\"\u003e\n\n \u003ch3 id=\"bacteriostatic-mixing-water-research-grade\" style=\"margin: 0 0 18px; color: #00455f; font-size: 20px; line-height: 1.35;\"\u003e\n BACTERIOSTATIC MIXING WATER – Research Grade Laboratory Solution\n \u003c\/h3\u003e\n\n \u003cdiv role=\"note\" aria-labelledby=\"research-only-bacteriostatic-mixing-water\" style=\"box-sizing: border-box; margin: 0 0 22px; padding: 18px 20px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; border-radius: 12px; font-size: 15px; line-height: 1.7;\"\u003e\n \u003ch4 id=\"research-only-bacteriostatic-mixing-water\" style=\"margin: 0 0 10px; color: #c00000; font-size: 16px; line-height: 1.45;\"\u003e\n For research purposes only\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n This product is supplied exclusively for scientific laboratory research and\n analytical purposes. It is not intended for human or animal use, consumption,\n clinical use or therapeutic application.\n \u003c\/p\u003e\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n It must not be used in any way that contravenes applicable laws or the\n requirements of the Medicines and Healthcare products Regulatory Agency.\n Research Scientific does not provide advice or recommendations concerning\n dosage, administration or use in humans or animals.\n \u003c\/p\u003e\n \u003cp style=\"margin: 0;\"\u003e\n \u003cstrong\u003eThese restrictions apply to every grade of this product.\u003c\/strong\u003e\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cul style=\"margin: 0 0 20px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eResearch-grade mixing water for scientific laboratory and analytical work.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eStated formulation: water containing 0.9% benzyl alcohol.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eSupplied in flip-top headspace vials designed for laboratory use.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n Research Scientific supplies Bacteriostatic Mixing Water as an aqueous laboratory\n solution. Review the formulation details and documentation notes below when\n assessing the product against the requirements of your laboratory procedure.\n \u003c\/p\u003e\n\n \u003csection aria-labelledby=\"bacteriostatic-mixing-water-chemical-information\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"bacteriostatic-mixing-water-chemical-information\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Chemical Information\n \u003c\/h3\u003e\n\n \u003cul style=\"margin: 0 0 18px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eProduct name:\u003c\/strong\u003e Bacteriostatic Mixing Water.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eAlternative description, as supplied:\u003c\/strong\u003e\n Sterile water with 0.9% benzyl alcohol.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003ePurity:\u003c\/strong\u003e\n Listed as not applicable in the supplied description. The stated 0.9%\n refers to solution strength, not a numerical purity result.\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003ch4 id=\"bacteriostatic-mixing-water-water-component\" style=\"margin: 20px 0 12px; color: #00455f; font-size: 16px; line-height: 1.45;\"\u003e\n Chemical Information – Water Component\n \u003c\/h4\u003e\n\n \u003cul style=\"margin: 0 0 18px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eChemical Abstracts Service registry number:\u003c\/strong\u003e 7732-18-5.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eMolecular formula of water:\u003c\/strong\u003e H\u003csub\u003e2\u003c\/sub\u003eO.\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003ch4 id=\"bacteriostatic-mixing-water-benzyl-alcohol-component\" style=\"margin: 24px 0 12px; color: #00455f; font-size: 16px; line-height: 1.45;\"\u003e\n Chemical Information – Benzyl Alcohol Component\n \u003c\/h4\u003e\n\n \u003cul style=\"margin: 0 0 18px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eChemical Abstracts Service registry number:\u003c\/strong\u003e 100-51-6.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eStated concentration in the solution:\u003c\/strong\u003e 0.9%.\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eConcentration clarification:\u003c\/strong\u003e\n The supplied description does not state whether 0.9% is expressed by mass,\n by volume or as mass per volume. Confirm the concentration basis against the\n manufacturer's formulation specification and completed batch documentation.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n The registry numbers identify the listed components, while H\u003csub\u003e2\u003c\/sub\u003eO\n describes water only, not the complete solution. The supplied formulation\n details have been retained; the conflicting Safety Data Sheet requires\n reconciliation as noted under Product Documentation below.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n \u003c!--\n Publication checks:\n The current product description supplies the two component registry numbers,\n the water formula and the stated 0.9% benzyl alcohol concentration.\n No concentration basis, percentage water content, additional ingredient,\n water-quality standard or numerical purity has been inferred.\n\n The source describes sterile water and sterile vials. These statements are\n retained as supplied specifications, not presented as verified batch results.\n Confirm supporting manufacturing and microbiological records.\n\n No product-specific ULTIMATE grade or processing record was supplied.\n The panel below describes the established range without asserting that\n additional purification or endotoxin testing applies to this solution.\n --\u003e\n\n \u003csection class=\"ultimate-research-grade\" aria-labelledby=\"ultimate-bacteriostatic-mixing-water-heading\" style=\"box-sizing: border-box; width: 100%; margin: 32px 0; font-family: Arial, Helvetica, sans-serif;\"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 28px;\n background-color: #080808;\n background-image: linear-gradient(135deg, #020202 0%, #090909 25%, #1c1c1c 56%, #101010 77%, #030303 100%);\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow: 0 16px 36px rgba(0, 0, 0, 0.25), inset 0 1px 0 rgba(255, 239, 170, 0.08);\n \"\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n pointer-events: none;\n background: radial-gradient(circle, rgba(255, 230, 139, 0.22) 0%, rgba(212, 175, 55, 0.08) 35%, rgba(212, 175, 55, 0) 73%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background: linear-gradient(90deg, transparent 0%, #d4af37 24%, #ffeea9 50%, #d4af37 76%, transparent 100%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n\n \u003cdiv style=\"\n display: inline-block;\n box-sizing: border-box;\n max-width: 100%;\n margin: 0 0 18px;\n padding: 8px 14px;\n color: #f7df88;\n background-color: rgba(212, 175, 55, 0.09);\n border: 1px solid rgba(247, 223, 136, 0.65);\n border-radius: 999px;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.6px;\n \"\u003e\n Premium Laboratory Range Information\n \u003c\/div\u003e\n\n \u003ch3 id=\"ultimate-bacteriostatic-mixing-water-heading\" style=\"margin: 0; color: #ffffff; font-size: 26px; font-weight: 700; line-height: 1.25;\"\u003e\n \u003cspan style=\"color: #f4d978; text-shadow: 0 0 18px rgba(212, 175, 55, 0.23);\"\u003eULTIMATE\u003c\/span\u003e\n \u003cspan style=\"display: inline-block; max-width: 100%; color: #ffffff;\"\u003eSpecification\u003c\/span\u003e\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 10px 0 0; color: #f0d77d; font-size: 15px; font-weight: 700; line-height: 1.6; letter-spacing: 0.5px;\"\u003e\n Bacteriostatic Mixing Water – grade availability requires confirmation\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"height: 1px; margin: 24px 0; background: linear-gradient(90deg, transparent, #d4af37, #f7df88, #d4af37, transparent);\"\u003e\u003c\/div\u003e\n\n \u003cp style=\"margin: 0; color: #f1f1f1; font-size: 15px; line-height: 1.8;\"\u003e\n The \u003cstrong style=\"color: #f7df88;\"\u003eULTIMATE range\u003c\/strong\u003e concerns additional\n preparative high-performance liquid chromatography purification and more\n stringent bacterial endotoxin testing. These processes are\n \u003cstrong style=\"color: #ffffff;\"\u003enot established for this Bacteriostatic Mixing Water listing\u003c\/strong\u003e.\n Contact Research Scientific to confirm whether a product-specific ULTIMATE\n option is available and to obtain its documented specification.\n \u003c\/p\u003e\n\n \u003cdiv style=\"display: flex; flex-wrap: wrap; gap: 14px; margin: 26px 0;\"\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Purification Specification\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n Any additional purification process must be supported by manufacturing\n records specifically applicable to the finished aqueous formulation supplied.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Endotoxin Specification\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n No endotoxin test method, result or acceptance limit is provided in the\n supplied product information. Request supporting records where required.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Batch-Specific Documentation\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n Review the benzyl alcohol concentration, formulation and available analytical\n results for the exact product, grade and batch under consideration.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003c\/div\u003e\n\n \u003cdiv style=\"padding: 18px 20px; background-color: rgba(212, 175, 55, 0.05); border: 1px solid rgba(255, 255, 255, 0.08); border-left: 4px solid #d4af37; border-radius: 8px;\"\u003e\n \u003ch4 style=\"margin: 0 0 8px; color: #f7df88; font-size: 15px; line-height: 1.4;\"\u003e\n Regular or ULTIMATE?\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #e5e5e5; font-size: 15px; line-height: 1.75;\"\u003e\n \u003cstrong style=\"color: #ffffff;\"\u003eThe Regular research-grade product is appropriate for routine laboratory work\u003c\/strong\u003e\n where its documented specification meets the requirements of your method.\n Consider ULTIMATE only where its availability and additional product-specific\n specification have been confirmed.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"margin: 20px 0 0; color: #cccccc; font-size: 14px; line-height: 1.7;\"\u003e\n \u003cstrong style=\"color: #f7df88;\"\u003eSpecification note:\u003c\/strong\u003e\n A grade designation alone does not establish numerical purity, analytical\n performance or sterility.\n \u003c\/p\u003e\n\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"bacteriostatic-mixing-water-laboratory-handling\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"bacteriostatic-mixing-water-laboratory-handling\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Laboratory Presentation and Handling\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003ePresentation and sterility:\u003c\/strong\u003e\n The supplied description identifies both the water-based solution and the\n flip-top headspace vials as sterile. Confirm the relevant manufacturing and\n batch records before relying on these claims for a laboratory procedure.\n No sterility test result is provided in the supplied description.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eLaboratory compatibility:\u003c\/strong\u003e\n Confirm that the stated water and benzyl alcohol formulation is compatible\n with the material being prepared and your laboratory's analytical method.\n Suitability should be assessed against the confirmed product specification.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n \u003cstrong\u003eHandling and storage:\u003c\/strong\u003e\n Request corrected, formulation-specific safety documentation before handling\n the product. Confirm the applicable storage conditions and any permitted\n period of use after opening with Research Scientific; these have not been\n established in the supplied product description.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"bacteriostatic-mixing-water-documentation\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"bacteriostatic-mixing-water-documentation\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Product Documentation\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eBatch and supplier records:\u003c\/strong\u003e\n Supporting supplier documentation is reviewed where supplied. Scan the code\n on the packaging, where provided, or contact Research Scientific for the\n records available for the selected product and batch.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP105.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n View Certificate of Analysis template\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n The linked certificate displayed an uncompleted template when checked on\n 10 September 2026. Request a completed certificate identifying Bacteriostatic\n Mixing Water, the batch number, formulation specification and reported\n analytical results.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP105.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n View Bacteriostatic Mixing Water Safety Data Sheet – Clarification Required\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n The linked Safety Data Sheet lists water with acetic acid and describes a\n lyophilised solid, which conflicts with the water and benzyl alcohol solution\n described here. Request a corrected document matching the confirmed composition\n and physical form before relying on it for handling, storage or disposal.\n \u003c\/p\u003e\n\n \u003c!--\n Document review: 10 September 2026.\n Both original product-specific addresses are retained unchanged.\n The Certificate of Analysis is an uncompleted template, not batch evidence.\n The Safety Data Sheet's identification and physical-properties sections\n conflict with the current product description. No acetic acid ingredient,\n lyophilised presentation or freezer-storage requirement has been adopted.\n Reconcile the formulation and catalogue reference with the manufacturer,\n replace the conflicting document, and update the visible status notes.\n --\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"bacteriostatic-mixing-water-delivery\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"bacteriostatic-mixing-water-delivery\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Tracked Delivery\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n Supplied with a tracked express delivery service. Refer to the dispatch\n information for the delivery option applicable to your order.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n\u003c\/div\u003e","brand":"peptidestore","offers":[{"title":"2ml","offer_id":50056249147730,"sku":"PEP106","price":2.5,"currency_code":"GBP","in_stock":true},{"title":"5ml","offer_id":50056249180498,"sku":"PEP106","price":5.95,"currency_code":"GBP","in_stock":true},{"title":"10ml","offer_id":50056249213266,"sku":"PEP106","price":8.95,"currency_code":"GBP","in_stock":true},{"title":"20ml","offer_id":50056249246034,"sku":"PEP106","price":15.5,"currency_code":"GBP","in_stock":true},{"title":"50ml","offer_id":50056249278802,"sku":"PEP106","price":33.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5ml Lab Pack 1","offer_id":51242145841490,"sku":"PEP106","price":17.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5ml Lab Pack 2","offer_id":51242148233554,"sku":"PEP106","price":34.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10ml Lab Pack 3","offer_id":51242149609810,"sku":"PEP106","price":32.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10ml Lab Pack 4","offer_id":51242150920530,"sku":"PEP106","price":63.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-benzyl-alcohol-uk-supply-ultra-pure-research-grade.png?v=1767865802"},{"product_id":"buy-benzyl-benzoate-online","title":"BENZYL BENZOATE - Research Grade","description":"\u003cdiv class=\"research-scientific-product-description\" lang=\"en-GB\" style=\"box-sizing: border-box; width: 100%; max-width: 100%; min-width: 0; font-family: Arial, Helvetica, sans-serif; font-size: 15px; line-height: 1.7; color: #222222; text-align: left; overflow-wrap: anywhere;\"\u003e\n\n \u003ch3 id=\"benzyl-benzoate-research-grade\" style=\"margin: 0 0 18px; color: #00455f; font-size: 20px; line-height: 1.35;\"\u003e\n BENZYL BENZOATE – Research Grade Laboratory Reagent\n \u003c\/h3\u003e\n\n \u003cdiv role=\"note\" aria-labelledby=\"research-only-benzyl-benzoate\" style=\"box-sizing: border-box; margin: 0 0 22px; padding: 18px 20px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; border-radius: 12px; font-size: 15px; line-height: 1.7;\"\u003e\n \u003ch4 id=\"research-only-benzyl-benzoate\" style=\"margin: 0 0 10px; color: #c00000; font-size: 16px; line-height: 1.45;\"\u003e\n For research purposes only\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n This product is supplied exclusively for scientific laboratory research and\n analytical purposes. It is not intended for human or animal use, consumption,\n clinical use or therapeutic application.\n \u003c\/p\u003e\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n It must not be used in any way that contravenes applicable laws or the\n requirements of the Medicines and Healthcare products Regulatory Agency.\n Research Scientific does not provide advice or recommendations concerning\n dosage, administration or use in humans or animals.\n \u003c\/p\u003e\n \u003cp style=\"margin: 0;\"\u003e\n \u003cstrong\u003eThese restrictions apply to every grade of this product.\u003c\/strong\u003e\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cul style=\"margin: 0 0 20px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eResearch-grade benzyl benzoate for scientific laboratory and analytical work.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eSupplied in flip-top headspace vials designed for laboratory use.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eBatch documentation available where supplied.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n Research Scientific supplies benzyl benzoate as a research-grade laboratory\n reagent. Review the chemical specification and available batch documentation\n when selecting material for your laboratory's analytical requirements.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n \u003cstrong\u003eThe stated weight refers to the contents of a single vial.\u003c\/strong\u003e\n Refer to the product label and applicable batch records for the declared\n quantity and specification of the selected product.\n \u003c\/p\u003e\n\n \u003csection aria-labelledby=\"benzyl-benzoate-chemical-information\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"benzyl-benzoate-chemical-information\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Chemical Information\n \u003c\/h3\u003e\n\n \u003cul style=\"margin: 0 0 18px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eProduct name:\u003c\/strong\u003e Benzyl benzoate.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eSynonym:\u003c\/strong\u003e Benzoic acid phenylmethyl ester.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eChemical Abstracts Service registry number:\u003c\/strong\u003e 120-51-4.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eMolecular formula:\u003c\/strong\u003e\n C\u003csub\u003e14\u003c\/sub\u003eH\u003csub\u003e12\u003c\/sub\u003eO\u003csub\u003e2\u003c\/sub\u003e.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eMolar mass:\u003c\/strong\u003e Approximately 212.24 grams per mole.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eStated purity specification:\u003c\/strong\u003e ≥99%.\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n The chemical details and \u003cstrong\u003e≥99% purity specification\u003c\/strong\u003e are retained\n from the supplied product description. The purity specification is not a\n verified result for an individual batch. Refer to a completed Certificate\n of Analysis for the analytical method, acceptance criterion and reported result.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n \u003c!--\n Product-specific publication checks:\n The synonym, registry number, molecular formula, approximate molar mass and\n stated purity specification are retained from the supplied BENZYL BENZOATE\n description. No independent chemical-identity or batch verification is claimed.\n\n The source describes the vials as sterile, not the benzyl benzoate contents.\n No product sterility, manufacturing location, additional ingredient, numerical\n endotoxin limit or fixed storage temperature has been inferred.\n\n The ULTIMATE panel retains the established range styling and position.\n No product-specific ULTIMATE grade, additional purification process or\n endotoxin-testing result has been established for this listing.\n --\u003e\n\n \u003csection class=\"ultimate-research-grade\" aria-labelledby=\"ultimate-benzyl-benzoate-heading\" style=\"box-sizing: border-box; width: 100%; margin: 32px 0; font-family: Arial, Helvetica, sans-serif;\"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 28px;\n background-color: #080808;\n background-image: linear-gradient(135deg, #020202 0%, #090909 25%, #1c1c1c 56%, #101010 77%, #030303 100%);\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow: 0 16px 36px rgba(0, 0, 0, 0.25), inset 0 1px 0 rgba(255, 239, 170, 0.08);\n \"\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n pointer-events: none;\n background: radial-gradient(circle, rgba(255, 230, 139, 0.22) 0%, rgba(212, 175, 55, 0.08) 35%, rgba(212, 175, 55, 0) 73%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background: linear-gradient(90deg, transparent 0%, #d4af37 24%, #ffeea9 50%, #d4af37 76%, transparent 100%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n\n \u003cdiv style=\"\n display: inline-block;\n box-sizing: border-box;\n max-width: 100%;\n margin: 0 0 18px;\n padding: 8px 14px;\n color: #f7df88;\n background-color: rgba(212, 175, 55, 0.09);\n border: 1px solid rgba(247, 223, 136, 0.65);\n border-radius: 999px;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.6px;\n \"\u003e\n Premium Laboratory Range Information\n \u003c\/div\u003e\n\n \u003ch3 id=\"ultimate-benzyl-benzoate-heading\" style=\"margin: 0; color: #ffffff; font-size: 26px; font-weight: 700; line-height: 1.25;\"\u003e\n \u003cspan style=\"color: #f4d978; text-shadow: 0 0 18px rgba(212, 175, 55, 0.23);\"\u003eULTIMATE\u003c\/span\u003e\n \u003cspan style=\"display: inline-block; max-width: 100%; color: #ffffff;\"\u003eSpecification\u003c\/span\u003e\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 10px 0 0; color: #f0d77d; font-size: 15px; font-weight: 700; line-height: 1.6; letter-spacing: 0.5px;\"\u003e\n Benzyl benzoate grade availability requires confirmation\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"height: 1px; margin: 24px 0; background: linear-gradient(90deg, transparent, #d4af37, #f7df88, #d4af37, transparent);\"\u003e\u003c\/div\u003e\n\n \u003cp style=\"margin: 0; color: #f1f1f1; font-size: 15px; line-height: 1.8;\"\u003e\n The \u003cstrong style=\"color: #f7df88;\"\u003eULTIMATE range\u003c\/strong\u003e concerns additional\n preparative high-performance liquid chromatography purification and more\n stringent bacterial endotoxin testing. These processes are\n \u003cstrong style=\"color: #ffffff;\"\u003enot established for this benzyl benzoate listing\u003c\/strong\u003e.\n Contact Research Scientific to confirm whether a product-specific ULTIMATE\n option is available and to obtain its documented specification.\n \u003c\/p\u003e\n\n \u003cdiv style=\"display: flex; flex-wrap: wrap; gap: 14px; margin: 26px 0;\"\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Purification Specification\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n Any additional purification process must be supported by manufacturing\n records specifically applicable to the benzyl benzoate supplied.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Endotoxin Specification\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n No endotoxin test method, result or acceptance limit is provided in the\n supplied product information. Request supporting records where required.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 15px; font-weight: 700; line-height: 1.5;\"\u003e\n Batch-Specific Documentation\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 15px; line-height: 1.7;\"\u003e\n Review the stated purity specification and available analytical results for the\n exact product, grade and batch under consideration.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003c\/div\u003e\n\n \u003cdiv style=\"padding: 18px 20px; background-color: rgba(212, 175, 55, 0.05); border: 1px solid rgba(255, 255, 255, 0.08); border-left: 4px solid #d4af37; border-radius: 8px;\"\u003e\n \u003ch4 style=\"margin: 0 0 8px; color: #f7df88; font-size: 15px; line-height: 1.4;\"\u003e\n Regular or ULTIMATE?\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #e5e5e5; font-size: 15px; line-height: 1.75;\"\u003e\n \u003cstrong style=\"color: #ffffff;\"\u003eThe Regular research-grade product is appropriate for routine laboratory work\u003c\/strong\u003e\n where its documented specification meets the requirements of your method.\n Consider ULTIMATE only where its availability and additional product-specific\n specification have been confirmed.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"margin: 20px 0 0; color: #cccccc; font-size: 14px; line-height: 1.7;\"\u003e\n \u003cstrong style=\"color: #f7df88;\"\u003eSpecification note:\u003c\/strong\u003e\n A grade designation alone does not establish numerical purity, analytical\n performance or sterility.\n \u003c\/p\u003e\n\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"benzyl-benzoate-laboratory-presentation\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"benzyl-benzoate-laboratory-presentation\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Laboratory Presentation and Handling\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eVial specification:\u003c\/strong\u003e\n The supplied description identifies the flip-top headspace vials as sterile.\n Confirm the relevant packaging records where sterility is required; this\n statement does not establish that the benzyl benzoate contents are sterile.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n \u003cstrong\u003eLaboratory handling:\u003c\/strong\u003e\n Assess the material against your laboratory's procedure and risk assessment.\n Follow the current, product-specific instructions for handling, storage and\n disposal. The Safety Data Sheet link requires attention as noted below.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"benzyl-benzoate-documentation\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"benzyl-benzoate-documentation\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Product Documentation\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eBatch and supplier records:\u003c\/strong\u003e\n Supporting supplier documentation is reviewed where supplied. Scan the code\n on the packaging, where provided, or contact Research Scientific for the\n records available for the selected product, grade and batch.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP107.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n View Certificate of Analysis template\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n The linked certificate displayed an uncompleted template when checked on\n 10 September 2026, without populated product identity, batch number or\n analytical results. Request a completed benzyl benzoate certificate that\n identifies the actual batch and reports the result against the stated\n ≥99% purity specification.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP107.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n View Benzyl Benzoate Safety Data Sheet – Supplied Document Link\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n This document address returned a not-found response when checked on\n 10 September 2026. Request the current, product-specific Safety Data Sheet\n from Research Scientific before handling the material.\n \u003c\/p\u003e\n\n \u003c!--\n Document review: 10 September 2026.\n Both product-specific addresses are retained unchanged from the source.\n The PEP107 Certificate of Analysis displayed an uncompleted template;\n it does not substantiate a purity result for the supplied batch.\n The PEP107 Safety Data Sheet address returned HTTP 404 when checked.\n Its contents could not be reviewed, and no replacement address is invented.\n Update the visible document-status notes after the certificate is completed\n and the correct Safety Data Sheet is available.\n --\u003e\n \u003c\/section\u003e\n\n \u003csection aria-labelledby=\"benzyl-benzoate-delivery\" style=\"margin: 28px 0 0;\"\u003e\n \u003ch3 id=\"benzyl-benzoate-delivery\" style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.4;\"\u003e\n Tracked Delivery\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n The supplied listing specifies secure packaging and frozen dispatch in\n insulated packaging using a tracked express delivery service. Confirm the\n dispatch temperature and packaging arrangements applicable to this benzyl\n benzoate product before shipment; the dispatch statement is not a long-term\n storage instruction.\n \u003c\/p\u003e\n \u003c\/section\u003e\n\n\u003c\/div\u003e","brand":"peptidestore","offers":[{"title":"2ml","offer_id":50056255177042,"sku":"PEP107","price":2.25,"currency_code":"GBP","in_stock":true},{"title":"5ml","offer_id":50056255209810,"sku":"PEP107","price":4.5,"currency_code":"GBP","in_stock":true},{"title":"10ml","offer_id":50056255242578,"sku":"PEP107","price":7.25,"currency_code":"GBP","in_stock":true},{"title":"20ml","offer_id":50056255275346,"sku":"PEP107","price":13.25,"currency_code":"GBP","in_stock":true},{"title":"50ml","offer_id":50056255308114,"sku":"PEP107","price":29.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 5ml Lab Pack 1","offer_id":51242164945234,"sku":"PEP107","price":15.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5ml Lab Pack 2","offer_id":51242166813010,"sku":"PEP107","price":30.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10ml Lab Pack 3","offer_id":51242169303378,"sku":"PEP107","price":28.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10ml Lab Pack 4","offer_id":51242171138386,"sku":"PEP107","price":55.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-benzyl-benzoate-online-research-grade-peptide.png?v=1767865802"},{"product_id":"buy-snap-8-peptide-uk","title":"SNAP-8 (Acetyl Octapeptide-3) - Research Grade Peptide","description":"\u003ch3 id=\"snap-8-acetyl-octapeptide-3-research-grade-peptide\"\u003e\n \u003cstrong\u003e\n SNAP-8 (Acetyl Octapeptide-3)\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade N-Acetylated Octapeptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade synthetic Acetyl Octapeptide-3 with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Defined linear sequence comprising eight amino-acid residues\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n N-terminally acetylated and C-terminally amidated molecular structure\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, chromatographic purity, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n All of our research peptides and related laboratory materials are supplied strictly for scientific research and laboratory use only. Each vial contains measured dry or lyophilised material prepared to support controlled laboratory handling, storage and analytical investigation. The stated nominal amount refers to the declared SNAP-8 or Acetyl Octapeptide-3 content of a single vial, subject to the applicable batch documentation. Where dissolution or reconstitution is required, the solvent, buffer, concentration, mixing procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT SNAP-8 MOLECULAR IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 19px 21px;\n background: linear-gradient(135deg, #f7f7f7 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 8px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.4px;\n text-transform: uppercase;\n \"\u003e\n Important Molecular Identity Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n This product listing describes\n \u003cstrong\u003e\n SNAP-8 with the complete structure Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/strong\u003e.\n The acetyl group is covalently attached to the peptide’s N-terminus, while the C-terminal aspartic acid residue is present in its amidated form.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.7;\n \"\u003e\n N-terminal acetylation should not be confused with an acetate counter-ion. Where the supplied material contains acetate, trifluoroacetate, sodium or another additional counter-ion, its identity and measured content should be stated separately in the applicable batch Certificate of Analysis.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT SNAP-8 MOLECULAR IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-snap-8-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #090909 25%,\n #1c1c1c 56%,\n #101010 77%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-snap-8-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n SNAP-8\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE SNAP-8 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and quality control. Following the standard synthesis, N-terminal acetylation, C-terminal amidation and purification process, the finished Acetyl Octapeptide-3 research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual peptide-related, deletion-sequence, acetylation-related, synthesis-related and process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard SNAP-8 synthesis and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification using the applicable batch-specific analytical method.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM QUALITY CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional peptide purification, enhanced endotoxin control and supporting batch-specific analytical documentation.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, chromatographic, formulation, peptide-characterisation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade SNAP-8 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE SNAP-8 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, amino-acid sequence, N-terminal acetylation, C-terminal amidation, chromatographic purity, peptide content, molecular form, counter-ion content, methionine oxidation, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"snap-8-acetyl-octapeptide-3-chemical-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n SNAP-8 (Acetyl Octapeptide-3)\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Acetyl Octapeptide-3\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n SNAP-8; SNAP8; Acetyl Octapeptide-3\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic N-terminally acetylated and C-terminally amidated linear octapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n Eight amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Modified Peptide Sequence:\u003c\/strong\u003e\n Ac-Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eModified One-Letter Sequence:\u003c\/strong\u003e\n Ac-EEMQRRAD-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnmodified Core Sequence:\u003c\/strong\u003e\n Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Covalently N-acetylated glutamic acid\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminally amidated aspartic acid residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAcetylation Clarification:\u003c\/strong\u003e\n The N-terminal acetyl group forms part of the covalent molecular structure and is not an acetate counter-ion\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Structure:\u003c\/strong\u003e\n Linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None; the SNAP-8 sequence contains no cysteine residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMethionine Content:\u003c\/strong\u003e\n One methionine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 868844-74-0\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e41\u003c\/sub\u003eH\u003csub\u003e70\u003c\/sub\u003eN\u003csub\u003e16\u003c\/sub\u003eO\u003csub\u003e16\u003c\/sub\u003eS\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 1075.17 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference InChIKey:\u003c\/strong\u003e\n KMACPCJUCHVVGP-FNRPHRCSSA-N\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the defined SNAP-8 covalent structure containing its N-terminal acetyl group and C-terminal amide, without additional counter-ions, residual water, solvents or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n The applicable chromatographic purity result, analytical method and acceptance criterion are stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic purity represents the relative chromatographic composition measured under the stated analytical conditions and should not automatically be interpreted as equivalent to total net SNAP-8 peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net Acetyl Octapeptide-3 content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion, residual-solvent and formulation results\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The complete eight-residue Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp sequence should be confirmed using the applicable synthesis, supplier and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Acetylation Confirmation:\u003c\/strong\u003e\n Product identity should confirm the presence and position of the covalent N-terminal acetyl group using suitable mass-spectrometry or equivalent molecular-identity data\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Amidation Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the amidated C-terminal aspartic acid residue and distinguish it from a free carboxylic acid terminal structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n Molecular identity should be supported by analytical mass data consistent with the specified SNAP-8 molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is the defined peptide alone, a sodium form, an acetate-containing form, a trifluoroacetate-containing form or another counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Sodium, acetate, trifluoroacetate or another counter-ion may affect the total supplied material mass and calculated net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as net SNAP-8 peptide equivalent or as total supplied salt-form or formulated material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water may contribute to the total material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from peptide synthesis, cleavage, acetylation, purification, concentration and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMethionine-Oxidation Control:\u003c\/strong\u003e\n Oxidation of the methionine residue is a distinct peptide-related quality attribute and should be assessed or controlled where required by the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely acetylated material, incompletely amidated material, methionine oxidation products and other synthesis-related or process-related substances are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, buffer, concentration and mixing procedure should be selected using the applicable batch documentation and validated laboratory method; a universal solvent instruction should not be applied to every SNAP-8 preparation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, amino-acid sequence, N-terminal acetylation, C-terminal amidation, chromatographic purity, net peptide content, methionine oxidation, water content, residual solvents, counter-ion content and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✓ Batch documentation – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ Certificate of Analysis – Accessible through the product QR code where a completed batch-specific document has been published.\n \u003cbr\u003e\n\n ✓ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ Sequence documentation – The complete eight-residue amino-acid sequence should be confirmed using the applicable synthesis and batch records.\n \u003cbr\u003e\n\n ✓ N-terminal modification documentation – Covalent N-terminal acetylation should be supported by appropriate molecular-identity data.\n \u003cbr\u003e\n\n ✓ C-terminal modification documentation – C-terminal amidation should be confirmed and distinguished from a free carboxylic acid terminal structure.\n \u003cbr\u003e\n\n ✓ Mass-spectrometry documentation – Molecular identity should be supported by analytical mass data consistent with the specified SNAP-8 structure.\n \u003cbr\u003e\n\n ✓ Purity documentation – The reported chromatographic purity applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ Peptide-content documentation – Net Acetyl Octapeptide-3 content should be distinguished from chromatographic purity and interpreted alongside water, counter-ion and residual-solvent results.\n \u003cbr\u003e\n\n ✓ Oxidation-control documentation – Methionine oxidation should be assessed or controlled where required by the applicable research specification.\n \u003cbr\u003e\n\n ✓ Chemical-form documentation – The defined peptide, sodium form, acetate-containing form, trifluoroacetate-containing form or other presentation should be identified clearly in the applicable product and batch records.\n \u003cbr\u003e\n\n ✓ Bacterial endotoxin documentation – The applicable bacterial endotoxin or lipopolysaccharide result should identify the test method, reporting units, method-suitability controls and acceptance criterion.\n \u003cbr\u003e\n\n ✓ Supplier documentation – Reviewed where supporting synthesis, acetylation, amidation, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ Fast, reliable and trackable express delivery – Securely packaged and dispatched using insulated or temperature-managed packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"snap-8-acetyl-octapeptide-3-product-overview\"\u003e\n \u003cstrong\u003eSNAP-8 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eSNAP-8 research-grade Acetyl Octapeptide-3\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, modified peptide characterisation, high-performance liquid chromatography assessment, mass-spectrometry workflows, formulation studies and reference-material comparison.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n SNAP-8 comprises the defined Glu-Glu-Met-Gln-Arg-Arg-Ala-Asp octapeptide sequence containing a covalent N-terminal acetyl group and a C-terminal amide. These terminal modifications form part of the molecular identity and should be confirmed through the applicable synthesis records and molecular-identity data.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Product identity, amino-acid sequence, N-terminal acetylation, C-terminal amidation, chromatographic purity, net peptide content, molecular form, counter-ion content, water content, residual solvents, methionine oxidation, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n The CAS number 868844-74-0, molecular formula C\u003csub\u003e41\u003c\/sub\u003eH\u003csub\u003e70\u003c\/sub\u003eN\u003csub\u003e16\u003c\/sub\u003eO\u003csub\u003e16\u003c\/sub\u003eS and average molecular weight of approximately 1075.17 g\/mol describe the defined Acetyl Octapeptide-3 molecular structure. Where the supplied laboratory material contains sodium, acetate, trifluoroacetate, residual water, solvents or formulation ingredients, the applicable batch documentation should identify their contribution to the total supplied material mass.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net SNAP-8 peptide content. Likewise, a bacterial endotoxin or lipopolysaccharide result does not establish sterility, molecular identity, correct N-terminal acetylation, correct C-terminal amidation, methionine oxidation status or the absence of every peptide-related and process-related impurity.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine analytical, chromatographic, formulation, peptide-characterisation and general laboratory work, the Regular SNAP-8 specification remains highly suitable. The premium black-and-gold ULTIMATE SNAP-8 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP051.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP051.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"2mg","offer_id":50255694922066,"sku":"PEP051","price":6.25,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50255694954834,"sku":"PEP051","price":12.5,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50255694987602,"sku":"PEP051","price":23.85,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50255695020370,"sku":"PEP051","price":42.25,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50255695053138,"sku":"PEP051","price":96.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51257602539858,"sku":"PEP051","price":50.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51257604800850,"sku":"PEP051","price":99.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51257605325138,"sku":"PEP051","price":93.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51257608012114,"sku":"PEP051","price":185.85,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648334614866,"sku":"PEP051U","price":17.25,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648334647634,"sku":"PEP051U","price":32.5,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648334680402,"sku":"PEP051U","price":58.5,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648334713170,"sku":"PEP051U","price":134.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648334745938,"sku":"PEP051U","price":70.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648334778706,"sku":"PEP051U","price":139.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 8 - Ultimate","offer_id":54648334811474,"sku":"PEP051U","price":130.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648334844242,"sku":"PEP051U","price":259.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-snap-8-peptide-uk-pure-fine-peptide-powder.png?v=1767865799"},{"product_id":"buy-aicar-online","title":"AICAR - Research Grade Peptide","description":"\u003ch3 id=\"aicar-acadesine-research-grade-nucleoside-analogue\"\u003e\n \u003cstrong\u003e\n AICAR (Acadesine)\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Nucleoside Analogue\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade AICAR nucleoside analogue with batch documentation available where supplied\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Batch identity, purity and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as measured laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n AICAR, also known as acadesine or AICA riboside, is a research-grade nucleoside analogue rather than a peptide. Each vial contains measured laboratory material prepared to support consistent scientific handling and storage. The stated weight refers to the contents of a single vial. Where dissolution or reconstitution is required, the solvent, concentration, handling procedure and storage conditions stated in the applicable batch documentation or validated laboratory method should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-aicar-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #0b0b0b 27%,\n #1c1c1c 56%,\n #101010 76%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative premium gold top edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.80) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.80) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-aicar-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n AICAR\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 8px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Purification and Endotoxin Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE AICAR range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of purification and quality control. Following the standard synthesis and purification process, the finished research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENDOTOXIN AND LPS TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- PREMIUM DOCUMENTATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Research Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring additional purification and an enhanced quality-control specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade AICAR product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of research quality, batch documentation and value. The ULTIMATE option is intended for projects where the additional high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE AICAR remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Identity, purity, residual solvent content, endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"aicar-acadesine-chemical-information\"\u003e\n \u003cstrong\u003eChemical Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n AICAR\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Name:\u003c\/strong\u003e\n Acadesine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical Classification:\u003c\/strong\u003e\n Ribonucleoside and nucleoside analogue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSynonyms:\u003c\/strong\u003e\n AICA riboside; AICAr; 5-aminoimidazole-4-carboxamide ribonucleoside; 5-aminoimidazole-4-carboxamide-1-β-D-ribofuranoside\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIUPAC Name:\u003c\/strong\u003e\n 5-amino-1-[(2R,3R,4S,5R)-3,4-dihydroxy-5-(hydroxymethyl)oxolan-2-yl]imidazole-4-carboxamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 2627-69-2\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n 17513\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e9\u003c\/sub\u003eH\u003csub\u003e14\u003c\/sub\u003eN\u003csub\u003e4\u003c\/sub\u003eO\u003csub\u003e5\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Weight:\u003c\/strong\u003e\n Approximately 258.23 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Laboratory powder or lyophilised material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Clarification:\u003c\/strong\u003e\n This listing refers to the non-phosphorylated AICA riboside commonly called acadesine. It should not be confused with phosphorylated AICA ribotide, also known as ZMP, which has a different molecular formula and molecular weight.\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✅ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✅ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✅ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✅ Identity documentation – Chemical identity, molecular formula and material form should be confirmed using the applicable batch records.\n \u003cbr\u003e\n\n ✅ Purity documentation – The reported purity specification applies only to the analytical method and batch stated in the Certificate of Analysis.\n \u003cbr\u003e\n\n ✅ Supplier documentation – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✅ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-controlled packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"aicar-acadesine-product-overview\"\u003e\n \u003cstrong\u003eAICAR Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eAICAR research-grade nucleoside analogue\u003c\/strong\u003e,\n also known as acadesine or AICA riboside, is supplied for controlled scientific laboratory investigation, analytical method development, biochemical characterisation and exploratory research workflows. The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. Chemical identity, purity, physical form, residual solvent content and other analytical specifications should be confirmed using the applicable batch Certificate of Analysis.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine laboratory investigations, the Regular AICAR specification remains highly suitable. The premium black-and-gold ULTIMATE AICAR option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for scientific projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP008.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP008.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50255705080146,"sku":"PEP008","price":2.85,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50255705112914,"sku":"PEP008","price":4.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50255705145682,"sku":"PEP008","price":6.25,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50255705178450,"sku":"PEP008","price":11.85,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50255705211218,"sku":"PEP008","price":26.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51242051830098,"sku":"PEP008","price":14.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51242054779218,"sku":"PEP008","price":27.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51242055729490,"sku":"PEP008","price":25.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51242056384850,"sku":"PEP008","price":49.85,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648334090578,"sku":"PEP008U","price":5.85,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648334123346,"sku":"PEP008U","price":9.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648334156114,"sku":"PEP008U","price":16.85,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648334188882,"sku":"PEP008U","price":36.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648334221650,"sku":"PEP008U","price":19.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648334254418,"sku":"PEP008U","price":37.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 8 - Ultimate","offer_id":54648334287186,"sku":"PEP008U","price":35.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648334319954,"sku":"PEP008U","price":69.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-aicar-online-ultra-pure-peptide-powder.png?v=1767865799"},{"product_id":"buy-adipotide-uk","title":"ADIPOTIDE - Research Grade Peptide","description":"\u003cdiv class=\"research-scientific-product-description\" style=\"box-sizing: border-box; width: 100%; max-width: 100%; min-width: 0; font-family: Arial, Helvetica, sans-serif; font-size: 15px; line-height: 1.7; color: #222222; overflow-wrap: anywhere;\"\u003e\n\n \u003ch3 id=\"adipotide-research-grade-peptide\" style=\"margin: 0 0 18px; color: #00455f; font-size: 20px; line-height: 1.35;\"\u003e\n ADIPOTIDE – Research Grade Peptide\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n \u003cul style=\"margin: 0 0 20px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eResearch-grade ADIPOTIDE supplied exclusively for laboratory use.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eSupplied as lyophilised powder in sealed, flip-top headspace vials.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003eProduct-specific batch documentation available where supplied.\u003c\/strong\u003e\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n The stated quantity applies to an individual vial unless the selected product option\n expressly identifies a multi-vial laboratory pack. Refer to the product label and\n applicable batch documentation for the declared peptide content, formulation and\n any additional ingredients.\n \u003c\/p\u003e\n\n \u003ch3 id=\"adipotide-chemical-information\" style=\"margin: 28px 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n Chemical Information\n \u003c\/h3\u003e\n\n \u003cul style=\"margin: 0 0 18px; padding-left: 24px;\"\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eProduct name:\u003c\/strong\u003e ADIPOTIDE.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eSynonym in the supplied description:\u003c\/strong\u003e Prohibitin-Targeting Peptide.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eChemical Abstracts Service registry number:\u003c\/strong\u003e\n Pending manufacturer confirmation. The number in the supplied description\n requires correction.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eMolecular formula in the supplied description:\u003c\/strong\u003e\n C\u003csub\u003e111\u003c\/sub\u003eH\u003csub\u003e206\u003c\/sub\u003eN\u003csub\u003e36\u003c\/sub\u003eO\u003csub\u003e28\u003c\/sub\u003eS\u003csub\u003e2\u003c\/sub\u003e.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003eCalculated average molar mass for the supplied formula:\u003c\/strong\u003e\n Approximately 2,557.2 grams per mole.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 8px;\"\u003e\n \u003cstrong\u003ePhysical presentation:\u003c\/strong\u003e Lyophilised laboratory powder.\n \u003c\/li\u003e\n \u003cli style=\"margin-bottom: 0;\"\u003e\n \u003cstrong\u003ePurity specification:\u003c\/strong\u003e\n No numerical purity is specified in the supplied description. Refer to a completed,\n batch-specific Certificate of Analysis for the analytical method, acceptance criterion\n and reported result.\n \u003c\/li\u003e\n \u003c\/ul\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eChemical-information clarification:\u003c\/strong\u003e\n The original description states an approximate molecular mass of 2,554 daltons.\n This has not been reconciled with the calculated average molar mass above.\n Confirm the registry number, peptide sequence, structural form and mass convention\n against the manufacturer's specification.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n The formula-based calculation is not a batch identity or purity result and does not\n establish the total composition of a formulated vial. Confirm the supplied salt form,\n associated water and any additional ingredients using the applicable manufacturing\n and batch records.\n \u003c\/p\u003e\n\n \u003c!--\n Publication checks, reviewed 10 September 2026:\n\n The source description and linked Safety Data Sheet give the registry number\n 1239669-64-9. It fails the Chemical Abstracts Service check-digit calculation:\n the weighted sum is 197, which gives 7, not 9. Do not simply change the final\n digit or infer a replacement identifier. Obtain the manufacturer's confirmed\n identity and registry number, then reconcile the description and documentation.\n\n The supplied formula C111H206N36O28S2 is retained without structural verification.\n The original approximate molecular mass of 2554 daltons is retained above as\n an unresolved source value. The separately labelled average molar mass is\n calculated using abridged standard atomic weights:\n (111 x 12.011) + (206 x 1.0080) + (36 x 14.007) +\n (28 x 15.999) + (2 x 32.06) = 2557.213 grams per mole.\n This is a formula-based calculation, not a measurement of the supplied batch.\n\n Check-digit reference:\n https:\/\/www.cas.org\/training\/documentation\/chemical-substances\/checkdig\n Atomic-weight reference:\n https:\/\/ciaaw.org\/abridged-atomic-weights.htm\n Product-specific source record:\n https:\/\/researchscientific.co.uk\/msds\/PEP006.pdf\n\n The ULTIMATE panel describes the established range specification conditionally.\n Confirm ADIPOTIDE-specific additional purification, endotoxin testing and grade\n availability against manufacturing records and completed batch documentation\n before publication. No numerical purity, endotoxin limit, sterility result,\n sequence, salt form or manufacturing location has been inferred.\n --\u003e\n\n \u003csection class=\"ultimate-research-grade\" aria-labelledby=\"ultimate-adipotide-heading\" style=\"box-sizing: border-box; width: 100%; margin: 32px 0; font-family: Arial, Helvetica, sans-serif;\"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 28px;\n background-color: #080808;\n background-image: linear-gradient(135deg, #020202 0%, #090909 25%, #1c1c1c 56%, #101010 77%, #030303 100%);\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow: 0 16px 36px rgba(0, 0, 0, 0.25), inset 0 1px 0 rgba(255, 239, 170, 0.08);\n \"\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n pointer-events: none;\n background: radial-gradient(circle, rgba(255, 230, 139, 0.22) 0%, rgba(212, 175, 55, 0.08) 35%, rgba(212, 175, 55, 0) 73%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background: linear-gradient(90deg, transparent 0%, #d4af37 24%, #ffeea9 50%, #d4af37 76%, transparent 100%);\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n\n \u003cdiv style=\"\n display: inline-block;\n box-sizing: border-box;\n max-width: 100%;\n margin: 0 0 18px;\n padding: 8px 14px;\n color: #f7df88;\n background-color: rgba(212, 175, 55, 0.09);\n border: 1px solid rgba(247, 223, 136, 0.65);\n border-radius: 999px;\n font-size: 11px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 1.4px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch3 id=\"ultimate-adipotide-heading\" style=\"margin: 0; color: #ffffff; font-size: 30px; font-weight: 700; line-height: 1.25;\"\u003e\n \u003cspan style=\"color: #f4d978; text-shadow: 0 0 18px rgba(212, 175, 55, 0.23);\"\u003eULTIMATE\u003c\/span\u003e\n \u003cspan style=\"display: inline-block; color: #ffffff;\"\u003eADIPOTIDE\u003c\/span\u003e\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 10px 0 0; color: #f0d77d; font-size: 13px; font-weight: 700; line-height: 1.6; letter-spacing: 0.5px;\"\u003e\n Additional chromatographic purification and more stringent endotoxin testing\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"height: 1px; margin: 24px 0; background: linear-gradient(90deg, transparent, #d4af37, #f7df88, #d4af37, transparent);\"\u003e\u003c\/div\u003e\n\n \u003cp style=\"margin: 0; color: #f1f1f1; font-size: 15px; line-height: 1.8;\"\u003e\n The \u003cstrong style=\"color: #f7df88;\"\u003eULTIMATE range\u003c\/strong\u003e is intended for\n laboratories requiring an additional preparative high-performance liquid\n chromatography purification stage beyond the Regular process, together with\n a more stringent bacterial endotoxin testing specification for lipopolysaccharides.\n For ADIPOTIDE, confirm that the selected ULTIMATE grade and batch are supported\n by the relevant manufacturing and analytical records.\n \u003c\/p\u003e\n\n \u003cdiv style=\"display: flex; flex-wrap: wrap; gap: 14px; margin: 26px 0;\"\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 13px; font-weight: 700; line-height: 1.5;\"\u003e\n Additional Purification\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 13px; line-height: 1.7;\"\u003e\n Review the product-specific record of the additional preparative\n high-performance liquid chromatography stage beyond the Regular\n purification process.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 13px; font-weight: 700; line-height: 1.5;\"\u003e\n More Stringent Endotoxin Testing\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 13px; line-height: 1.7;\"\u003e\n Confirm the analytical method, acceptance criteria and reported results\n against the applicable ULTIMATE bacterial endotoxin specification.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cdiv style=\"box-sizing: border-box; flex: 1 1 200px; min-width: 0; padding: 20px; background: linear-gradient(145deg, #232323, #080808); border: 1px solid rgba(212, 175, 55, 0.44); border-radius: 11px;\"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"width: 34px; height: 3px; margin-bottom: 13px; background: linear-gradient(90deg, #b8860b, #f7df88, #d4af37); border-radius: 3px;\"\u003e\u003c\/div\u003e\n \u003ch4 style=\"margin: 0 0 9px; color: #f7df88; font-size: 13px; font-weight: 700; line-height: 1.5;\"\u003e\n Batch-Specific Documentation\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #dddddd; font-size: 13px; line-height: 1.7;\"\u003e\n Match the manufacturer's specification and completed analytical records\n to ADIPOTIDE, the selected grade and the batch number.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003c\/div\u003e\n\n \u003cdiv style=\"padding: 18px 20px; background-color: rgba(212, 175, 55, 0.05); border: 1px solid rgba(255, 255, 255, 0.08); border-left: 4px solid #d4af37; border-radius: 8px;\"\u003e\n \u003ch4 style=\"margin: 0 0 8px; color: #f7df88; font-size: 15px; line-height: 1.4;\"\u003e\n Regular or ULTIMATE?\n \u003c\/h4\u003e\n \u003cp style=\"margin: 0; color: #e5e5e5; font-size: 14px; line-height: 1.75;\"\u003e\n \u003cstrong style=\"color: #ffffff;\"\u003eOur Regular ADIPOTIDE remains a suitable choice for routine laboratory work\u003c\/strong\u003e\n where its documented specification meets the requirements of the intended\n method. Select ULTIMATE where the documented additional purification stage\n and more stringent endotoxin specification are required by your laboratory\n procedure.\n \u003c\/p\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"margin: 20px 0 0; color: #cccccc; font-size: 12px; line-height: 1.7;\"\u003e\n \u003cstrong style=\"color: #f7df88;\"\u003eFor research use only.\u003c\/strong\u003e\n The ULTIMATE designation does not, by itself, establish a numerical purity,\n an endotoxin limit or sterility. Confirm the relevant specification and results\n in the batch documentation. Neither grade is intended for human or animal use.\n \u003c\/p\u003e\n\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/section\u003e\n\n \u003ch3 style=\"margin: 28px 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n Formulation Process and Quality Assurance\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eProduct specification:\u003c\/strong\u003e\n Review the applicable manufacturer and analytical records for the material's identity,\n declared content, formulation and quality requirements. Match the documentation to\n ADIPOTIDE, the selected grade and the batch number.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n \u003cstrong\u003eSupplier documentation:\u003c\/strong\u003e\n Supplier records are reviewed where supplied. Assess the tests performed and reported\n results against the documented analytical methods and acceptance criteria, rather than\n relying on a grade name alone.\n \u003c\/p\u003e\n\n \u003ch3 style=\"margin: 28px 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n Laboratory Handling and Reconstitution\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n The supplied description identifies the powder and vials as sterile and states that\n the lyophilised powder has been finely milled and sieved. Confirm these processing\n and sterility claims against the relevant manufacturing and batch records before\n relying on them for a laboratory procedure.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n The supplied product information identifies bacteriostatic water containing 0.9% benzyl\n alcohol, or a suitable equivalent, as the reconstitution medium. Confirm that the\n selected medium, concentration and handling conditions are compatible with the exact\n supplied formulation and your laboratory's validated procedure.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n Follow the product-specific handling, storage and disposal instructions. Research Scientific\n does not provide advice or recommendations regarding dosage, administration or use in\n humans or animals.\n \u003c\/p\u003e\n\n \u003ch3 style=\"margin: 28px 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n Batch Documentation and Delivery\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 16px;\"\u003e\n \u003cstrong\u003eDocumentation access:\u003c\/strong\u003e\n Scan the code on the packaging, where provided, or use the product-document links below.\n For analytical results, request a completed Certificate of Analysis that identifies\n the actual product, selected grade and batch. Consult the current, product-specific\n Safety Data Sheet to support laboratory risk assessment, safe handling, storage and disposal.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n \u003cstrong\u003eTracked delivery:\u003c\/strong\u003e\n Securely packaged and dispatched frozen in insulated packaging using a tracked\n delivery service. Follow the product's storage instructions upon receipt.\n \u003c\/p\u003e\n\n \u003chr style=\"border: 0; border-top: 1px solid #dddddd; margin: 26px 0;\"\u003e\n\n \u003ch3 style=\"margin: 0 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n ADIPOTIDE Product Overview\n \u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n Research Scientific supplies ADIPOTIDE as a lyophilised research-grade peptide for\n controlled laboratory handling and analytical work. Review the declared composition\n and completed batch documentation to select a specification appropriate to your\n laboratory's requirements.\n \u003c\/p\u003e\n\n \u003ch3 style=\"margin: 28px 0 14px; color: #00455f; font-size: 18px; line-height: 1.35;\"\u003e\n Product Documentation\n \u003c\/h3\u003e\n\n \u003c!--\n Both product-specific document addresses are retained from the supplied HTML.\n When checked on 10 September 2026, the Certificate of Analysis displayed an\n uncompleted template, with no populated product identity, batch number or results.\n It has not been used to substantiate analytical, purity or ULTIMATE claims.\n Replace or complete the document and update the visible wording when verified\n ADIPOTIDE batch documentation is available.\n\n The linked Safety Data Sheet identifies ADIPOTIDE and product code PEP006,\n with revision date 9 February 2025. Its registry number requires reconciliation\n with the manufacturer's confirmed specification, as noted above.\n --\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP006.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n View Certificate of Analysis template\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 20px;\"\u003e\n The linked document currently displays an uncompleted certificate template.\n Contact Research Scientific for a completed ADIPOTIDE certificate identifying the\n actual product, selected grade and batch before relying on reported analytical results.\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0 0 12px;\"\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP006.pdf\" target=\"_blank\" rel=\"noopener noreferrer\" style=\"color: #00455f; font-weight: 700; text-decoration: underline; text-underline-offset: 3px;\"\u003e\n View ADIPOTIDE Safety Data Sheet\n \u003c\/a\u003e\n \u003c\/p\u003e\n\n \u003cp style=\"margin: 0;\"\u003e\n Confirm that the Safety Data Sheet matches the exact material and formulation supplied.\n Request an updated document where the product identity or specification requires clarification.\n \u003c\/p\u003e\n\n\u003c\/div\u003e","brand":"Nupex","offers":[{"title":"2mg","offer_id":50255706587474,"sku":"PEP006","price":12.95,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50255706620242,"sku":"PEP006","price":27.25,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50255706653010,"sku":"PEP006","price":51.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50255706685778,"sku":"PEP006","price":94.95,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50255706718546,"sku":"PEP006","price":216.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51242036363602,"sku":"PEP006","price":113.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51242036986194,"sku":"PEP006","price":225.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51242038067538,"sku":"PEP006","price":210.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51242038755666,"sku":"PEP006","price":420.25,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648333304146,"sku":"PEP006U","price":38.5,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648333336914,"sku":"PEP006U","price":71.95,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648333369682,"sku":"PEP006U","price":131.5,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648333402450,"sku":"PEP006U","price":302.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648333435218,"sku":"PEP006U","price":158.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648333467986,"sku":"PEP006U","price":315.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 8 - Ultimate","offer_id":54648333500754,"sku":"PEP006U","price":294.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648333533522,"sku":"PEP006U","price":587.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-adipotide-uk-pure-fine-peptide-powder.png?v=1767865802"},{"product_id":"buy-ace-031-uk-research-grade-peptide","title":"Ace-031 (95% Untagged Premium) – Research Grade Peptide","description":"\u003ch3 id=\"ace031-95-percent-untagged-premium\"\u003e\n \u003cstrong\u003e\n ACE-031 (95% Untagged Premium)\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, sans-serif;\"\u003e\n – Research-Grade Recombinant Fusion Protein\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Research-grade recombinant protein material with a batch-specific purity specification of at least 95% where confirmed by the applicable Certificate of Analysis\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Untagged presentation where the absence of an engineered affinity or detection tag is confirmed by the applicable batch documentation\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Supplied as lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/span\u003e\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ACE-031 is a specialist recombinant protein material rather than a conventional short-chain peptide. Each vial contains lyophilised material prepared to support controlled laboratory handling and storage. The stated weight refers to the contents of a single vial. Where reconstitution is required, the solvent, buffer, concentration, handling procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or batch-specific technical documentation should be followed. We do not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-ace031-untagged-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 32px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 36px;\n background:\n linear-gradient(\n 135deg,\n #020202 0%,\n #0b0b0b 27%,\n #1b1b1b 56%,\n #101010 76%,\n #030303 100%\n );\n border: 1px solid #d4af37;\n border-radius: 17px;\n box-shadow:\n 0 20px 48px rgba(0, 0, 0, 0.36),\n 0 0 0 1px rgba(212, 175, 55, 0.08),\n inset 0 1px 0 rgba(255, 239, 170, 0.08),\n inset 0 0 32px rgba(212, 175, 55, 0.035);\n \"\u003e\n \u003c!-- Decorative upper gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -135px;\n right: -105px;\n width: 360px;\n height: 360px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 230, 139, 0.25) 0%,\n rgba(212, 175, 55, 0.12) 30%,\n rgba(212, 175, 55, 0.03) 52%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative lower gold glow --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -170px;\n left: -125px;\n width: 350px;\n height: 350px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.15) 0%,\n rgba(212, 175, 55, 0.05) 40%,\n rgba(212, 175, 55, 0) 73%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- Decorative gold edge --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.8) 24%,\n rgba(255, 238, 169, 1) 50%,\n rgba(247, 223, 136, 0.8) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.14),\n rgba(212, 175, 55, 0.045)\n );\n border: 1px solid rgba(247, 223, 136, 0.72);\n border-radius: 999px;\n box-shadow:\n 0 5px 15px rgba(0, 0, 0, 0.22),\n inset 0 1px 0 rgba(255, 255, 255, 0.06);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-ace031-untagged-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 18px rgba(212, 175, 55, 0.23),\n 0 1px 0 rgba(255, 255, 255, 0.09);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n ACE-031\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 7px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.9px;\n text-transform: uppercase;\n \"\u003e\n 95% Untagged Premium Specification\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 11px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.68;\n letter-spacing: 0.15px;\n \"\u003e\n Additional high-performance liquid chromatography purification and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for demanding scientific laboratory workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 25px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.72) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.72) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.8;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE ACE-031 range\n \u003c\/strong\u003e\n is our highest laboratory specification for research organisations requiring an enhanced level of purification and quality control. Following the standard production and purification process, the finished research material undergoes an additional preparative high-performance liquid chromatography purification stage designed to reduce residual process-related impurities further. ULTIMATE batches are also assessed under a more stringent bacterial endotoxin and lipopolysaccharide testing specification, with the applicable analytical and batch documentation provided where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 27px 0;\n \"\u003e\n \u003c!-- HPLC CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- LPS CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Assessed under the enhanced ULTIMATE bacterial endotoxin and lipopolysaccharide testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- DOCUMENTATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 200px;\n min-width: 0;\n padding: 20px;\n background:\n linear-gradient(\n 145deg,\n rgba(35, 35, 35, 0.97),\n rgba(8, 8, 8, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.44);\n border-radius: 11px;\n box-shadow:\n 0 9px 22px rgba(0, 0, 0, 0.24),\n inset 0 1px 0 rgba(255, 255, 255, 0.03);\n \"\u003e\n \u003cdiv style=\"\n width: 34px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Premium Batch Specification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.62;\n \"\u003e\n Intended for laboratory projects requiring the additional purification and enhanced analytical testing specification.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 19px 21px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.055),\n rgba(255, 255, 255, 0.025)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.08);\n border-right: 1px solid rgba(255, 255, 255, 0.08);\n border-bottom: 1px solid rgba(255, 255, 255, 0.08);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.012),\n 0 6px 16px rgba(0, 0, 0, 0.12);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 7px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular 95% Untagged Premium or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For the majority of routine analytical, investigative and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular ACE-031 95% Untagged Premium product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of research quality, batch documentation and value. The ULTIMATE option is intended for projects where the additional high-performance liquid chromatography purification stage and more stringent bacterial endotoxin and lipopolysaccharide testing specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.62;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE ACE-031 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Purity, identity, tag status, endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable Certificate of Analysis.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"ace031-95-percent-untagged-scientific-information\"\u003e\n \u003cstrong\u003eScientific and Product Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n ACE-031 (95% Untagged Premium)\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Type:\u003c\/strong\u003e\n Research-grade recombinant fusion protein\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Structural Description:\u003c\/strong\u003e\n Extracellular ligand-binding domain of human activin receptor type IIB linked to the Fc region of human immunoglobulin G1\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eReference Protein Configuration:\u003c\/strong\u003e\n Glycosylated homodimeric fusion protein\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Specification:\u003c\/strong\u003e\n At least 95% where confirmed by the applicable batch Certificate of Analysis using the stated analytical method\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUntagged Specification:\u003c\/strong\u003e\n Supplied without an engineered affinity or detection tag where confirmed by batch-specific analytical documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIUPAC Name:\u003c\/strong\u003e\n Not applicable to a recombinant fusion protein\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n Refer to the applicable supplier and batch documentation; any assigned CAS number must correspond to the identity of the material actually supplied\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n Not represented appropriately by a single fixed small-molecule formula because protein composition and glycosylation characteristics may vary according to the expression and production system\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Weight:\u003c\/strong\u003e\n Expression-system, glycosylation and analytical-method dependent; refer to the applicable Certificate of Analysis and protein characterisation data\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Lyophilised laboratory material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n Refer to the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n ✅ Batch documentation – Certificate of Analysis documentation is provided where supplied for review.\n \u003cbr\u003e\n\n ✅ Certificate of Analysis – Accessible through the product QR code where provided for the applicable batch.\n \u003cbr\u003e\n\n ✅ Safety Data Sheet – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✅ Purity documentation – The stated purity specification applies only where confirmed by the applicable batch analytical results.\n \u003cbr\u003e\n\n ✅ Untagged verification – Tag status is stated only where supported by appropriate supplier or independent analytical documentation.\n \u003cbr\u003e\n\n ✅ Supplier documentation – Reviewed where supporting identity, production and analytical records are supplied.\n \u003cbr\u003e\n\n ✅ Fast, reliable and trackable delivery – Securely packaged and dispatched using insulated or temperature-controlled packaging where required by the applicable transport and storage specification.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003cp\u003e\n \u003cstrong\u003e\n \u003cspan style=\"color: #c00000;\"\u003e\n For Research Use Only\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\n \u003cspan style=\"color: #c00000;\"\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"\n width: 100%;\n border: 0;\n border-top: 1px solid #cccccc;\n \"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"ace031-95-percent-untagged-product-overview\"\u003e\n \u003cstrong\u003eACE-031 95% Untagged Premium Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n Our\n \u003cstrong\u003eACE-031 95% Untagged Premium research-grade recombinant protein\u003c\/strong\u003e\n is supplied for controlled scientific laboratory investigation, analytical method development, protein characterisation and exploratory research workflows. The material is handled with a focus on batch traceability, documented quality control and consistent laboratory presentation. The 95% purity and untagged designations are batch-specific specifications and should be confirmed using the applicable Certificate of Analysis and supporting analytical records.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003cspan style=\"color: #000000;\"\u003e\n For the majority of routine laboratory investigations, the Regular ACE-031 95% Untagged Premium specification remains highly suitable. The black-and-gold ULTIMATE ACE-031 option provides an additional high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin and lipopolysaccharide testing specification for research projects requiring enhanced quality-control parameters.\n \u003c\/span\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP003.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP003.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"peptidestore","offers":[{"title":"2mg","offer_id":50255708946770,"sku":"PEP003","price":183.25,"currency_code":"GBP","in_stock":false},{"title":"5mg","offer_id":50255708979538,"sku":"PEP003","price":427.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50255709012306,"sku":"PEP003","price":797.85,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50255709045074,"sku":"PEP003","price":1479.25,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50255709077842,"sku":"PEP003","price":3413.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51241958539602,"sku":"PEP003","price":1778.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51241959850322,"sku":"PEP003","price":3555.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51241960997202,"sku":"PEP003","price":3318.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51241962111314,"sku":"PEP003","price":6636.5,"currency_code":"GBP","in_stock":true},{"title":"5mg - Ultimate","offer_id":54648332910930,"sku":"PEP003U","price":598.95,"currency_code":"GBP","in_stock":true},{"title":"10mg - Ultimate","offer_id":54648332943698,"sku":"PEP003U","price":1115.85,"currency_code":"GBP","in_stock":true},{"title":"20mg - Ultimate","offer_id":54648332976466,"sku":"PEP003U","price":2071.95,"currency_code":"GBP","in_stock":true},{"title":"50mg - Ultimate","offer_id":54648333009234,"sku":"PEP003U","price":4778.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54648333042002,"sku":"PEP003U","price":2489.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54648333074770,"sku":"PEP003U","price":4977.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 8 - Ultimate","offer_id":54648333107538,"sku":"PEP003U","price":4646.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54648333140306,"sku":"PEP003U","price":9291.25,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-ace-031-uk-peptide-powder-95-untagged-premium.png?v=1767865779"},{"product_id":"acetyl-glp1-gip-peptide-research-grade","title":"ACETYL GLP1+GIP - Research Grade Peptide","description":"\u003ch3 id=\"acetyl-glp-1-gip-research-grade-peptide-preparation\"\u003e\n \u003cstrong\u003e\n ACETYL GLP-1 + GIP\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, Helvetica, sans-serif;\"\u003e\n – Research-Grade Peptide Preparation\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n Batch-defined acetylated GLP-1\/GIP research peptide preparation\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Exact peptide identity, sequence, modification pattern and composition stated in the applicable completed Certificate of Analysis\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Batch identity, chromatographic purity, molecular mass, peptide content and analytical specifications documented where supplied\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Restricted professional laboratory supply subject to customer, organisation and intended-use verification\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n ACETYL GLP-1 + GIP is a catalogue designation for a batch-defined modified peptide preparation. The product name alone does not establish whether the supplied material is one sequence-defined peptide containing combined structural characteristics or a controlled mixture of two separate peptide components. The applicable batch Certificate of Analysis must identify which product format has been supplied.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Each vial contains measured laboratory material prepared to support controlled scientific handling, storage, analytical method development, chromatographic evaluation and mass-spectrometry characterisation. The stated nominal quantity refers to the declared peptide content of the vial according to the composition and assay basis stated in the applicable batch documentation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Where laboratory dissolution is required, the solvent, buffer, concentration, mixing procedure, material-compatibility controls and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal bacteriostatic-water instruction should not be applied to every peptide sequence, blend, salt form or modified peptide preparation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Research Scientific Ltd does not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n\u003c\/p\u003e\n\n\u003c!-- RESTRICTED PROFESSIONAL LABORATORY SUPPLY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 21px 23px;\n background: linear-gradient(135deg, #f7f7f7 0%, #ededed 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #222222;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 9px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.5px;\n text-transform: uppercase;\n \"\u003e\n Restricted Professional Laboratory Supply\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 10px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n Supply is restricted to verified commercial, institutional or academic laboratory organisations. An order may require a purchase order on company or institutional letterhead, a professional email address, confirmation of the intended analytical or laboratory application and delivery to an appropriate registered commercial or institutional address.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n This research material is not offered as an authorised finished medicinal product and must not be purchased or used for personal, clinical, diagnostic, pharmacy-compounding, veterinary or self-administration purposes.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END RESTRICTED PROFESSIONAL LABORATORY SUPPLY NOTICE --\u003e\n\n\u003c!-- IMPORTANT PRODUCT IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 21px 23px;\n background: linear-gradient(135deg, #f9f9f9 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #8a6d1d;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 9px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.5px;\n text-transform: uppercase;\n \"\u003e\n Batch-Defined Molecular Identity\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 11px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n The commercial designation\n \u003cstrong\u003eACETYL GLP-1 + GIP\u003c\/strong\u003e\n is not, by itself, a complete chemical identity. The plus symbol does not establish whether the material is a single modified peptide or a mixture containing two separate peptide components.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 11px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n Where PEP063 is supplied as a\n \u003cstrong\u003esingle sequence-defined peptide\u003c\/strong\u003e,\n its complete amino-acid sequence, stereochemistry, N-terminal and C-terminal structures, acetylation position, any linker or lipid modification, molecular formula, calculated molecular weight and measured mass must be recorded in the applicable batch documentation.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 11px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n Where PEP063 is supplied as a\n \u003cstrong\u003etwo-component peptide preparation\u003c\/strong\u003e,\n the identity, complete sequence, modification pattern, molecular formula, molecular weight, individual quantity and quantitative ratio of each component must be stated separately. A multi-component preparation does not have one meaningful molecular formula or one component molecular weight.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n Product release should be based on the completed Certificate of Analysis and matching Safety Data Sheet rather than the catalogue name alone.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT PRODUCT IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-acetyl-glp-1-gip-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 34px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 38px 29px;\n background:\n linear-gradient(\n 135deg,\n #010101 0%,\n #080808 23%,\n #222222 53%,\n #101010 78%,\n #020202 100%\n );\n border: 1px solid #d4af37;\n border-radius: 18px;\n box-shadow:\n 0 24px 54px rgba(0, 0, 0, 0.40),\n 0 0 0 1px rgba(212, 175, 55, 0.10),\n inset 0 1px 0 rgba(255, 239, 170, 0.10),\n inset 0 0 38px rgba(212, 175, 55, 0.045);\n \"\u003e\n \u003c!-- DECORATIVE UPPER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -150px;\n right: -110px;\n width: 390px;\n height: 390px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 231, 145, 0.27) 0%,\n rgba(212, 175, 55, 0.13) 31%,\n rgba(212, 175, 55, 0.035) 53%,\n rgba(212, 175, 55, 0) 74%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE LOWER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -180px;\n left: -130px;\n width: 370px;\n height: 370px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.17) 0%,\n rgba(212, 175, 55, 0.055) 41%,\n rgba(212, 175, 55, 0) 74%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE GOLD TOP EDGE --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.82) 24%,\n rgba(255, 240, 176, 1) 50%,\n rgba(247, 223, 136, 0.82) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.16),\n rgba(212, 175, 55, 0.05)\n );\n border: 1px solid rgba(247, 223, 136, 0.74);\n border-radius: 999px;\n box-shadow:\n 0 6px 16px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.07);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-acetyl-glp-1-gip-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 19px rgba(212, 175, 55, 0.25),\n 0 1px 0 rgba(255, 255, 255, 0.10);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n ACETYL GLP-1 + GIP\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 9px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.8px;\n text-transform: uppercase;\n \"\u003e\n Additional Preparative HPLC Purification, Enhanced Composition Control and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 12px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.72;\n letter-spacing: 0.1px;\n \"\u003e\n A premium laboratory specification incorporating additional preparative high-performance liquid chromatography purification, enhanced molecular-identity control and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for demanding analytical research workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 26px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.74) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.74) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE ACETYL GLP-1 + GIP range\n \u003c\/strong\u003e\n is our premium research specification for professional laboratories requiring an enhanced level of peptide purification, composition control and batch quality assurance. The exact ULTIMATE manufacturing statement depends upon whether the applicable PEP063 batch is a single sequence-defined peptide or a controlled two-component peptide preparation.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n Where PEP063 is a single sequence-defined peptide, the finished molecule undergoes an additional preparative high-performance liquid chromatography purification stage after the standard synthesis and purification workflow. This supplementary process is designed to reduce chromatographically separable peptide-related, sequence-related, modification-related and process-related impurities further.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n Where PEP063 is a defined two-component preparation, each peptide component undergoes the applicable additional preparative high-performance liquid chromatography purification stage before controlled quantitative blending. The final preparation is then assessed for component identity, declared composition and blend ratio using the applicable batch-specific analytical methods.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n ULTIMATE batches are also assessed against a more stringent bacterial endotoxin or lipopolysaccharide release specification than the Regular range. The analytical method, reporting units, acceptance criterion, method-suitability controls and batch result should be stated in the corresponding Certificate of Analysis where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 29px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 21px;\n background:\n linear-gradient(\n 145deg,\n rgba(36, 36, 36, 0.98),\n rgba(7, 7, 7, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.46);\n border-radius: 11px;\n box-shadow:\n 0 10px 24px rgba(0, 0, 0, 0.27),\n inset 0 1px 0 rgba(255, 255, 255, 0.035);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.65;\n \"\u003e\n An additional preparative high-performance liquid chromatography purification stage is completed for the defined peptide molecule or separately for each component before quantitative blending.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED COMPOSITION CONTROL CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 21px;\n background:\n linear-gradient(\n 145deg,\n rgba(36, 36, 36, 0.98),\n rgba(7, 7, 7, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.46);\n border-radius: 11px;\n box-shadow:\n 0 10px 24px rgba(0, 0, 0, 0.27),\n inset 0 1px 0 rgba(255, 255, 255, 0.035);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Enhanced Identity and Composition Control\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.65;\n \"\u003e\n Batch-specific documentation records the exact molecular identity or, for a blend, the identity, quantity and declared ratio of each separately characterised peptide component.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 21px;\n background:\n linear-gradient(\n 145deg,\n rgba(36, 36, 36, 0.98),\n rgba(7, 7, 7, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.46);\n border-radius: 11px;\n box-shadow:\n 0 10px 24px rgba(0, 0, 0, 0.27),\n inset 0 1px 0 rgba(255, 255, 255, 0.035);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.65;\n \"\u003e\n The final batch is assessed against the enhanced ULTIMATE bacterial endotoxin or lipopolysaccharide specification using an appropriate product-specific method-suitability assessment.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 21px 23px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.065),\n rgba(255, 255, 255, 0.026)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.085);\n border-right: 1px solid rgba(255, 255, 255, 0.085);\n border-bottom: 1px solid rgba(255, 255, 255, 0.085);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.014),\n 0 7px 17px rgba(0, 0, 0, 0.14);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.75;\n \"\u003e\n For the majority of routine analytical method development, chromatographic assessment, liquid chromatography–mass spectrometry comparison, peptide characterisation, reference-material evaluation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular ACETYL GLP-1 + GIP product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of research quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification, enhanced composition control and more stringent bacterial endotoxin or lipopolysaccharide specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.65;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE ACETYL GLP-1 + GIP remains strictly for verified professional scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use, pharmacy compounding, self-administration or therapeutic application. Molecular identity, complete sequence or component sequences, acetylation, other structural modifications, chromatographic purity, net peptide content, component ratio, molecular form, counter-ion content, residual solvents, water content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable completed Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"acetyl-glp-1-gip-chemical-composition-information\"\u003e\n \u003cstrong\u003eChemical, Structural and Composition Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eCatalogue Product Name:\u003c\/strong\u003e\n ACETYL GLP-1 + GIP\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCatalogue Product Identifier:\u003c\/strong\u003e\n PEP063\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Technical Description:\u003c\/strong\u003e\n Batch-defined acetylated GLP-1\/GIP research peptide preparation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Status:\u003c\/strong\u003e\n The catalogue name alone does not define one unique molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRequired Product Classification:\u003c\/strong\u003e\n The completed batch documentation must identify PEP063 as either one sequence-defined modified peptide or a quantitative mixture of separately identified peptide components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSingle-Molecule Format:\u003c\/strong\u003e\n Where supplied as one molecule, the complete peptide sequence and every covalent modification must be stated\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMulti-Component Format:\u003c\/strong\u003e\n Where supplied as a mixture, each component must be listed separately with its complete sequence, modification pattern, molecular identity and quantity\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIUPAC or Sequence-Based Name:\u003c\/strong\u003e\n Batch-specific and not determinable from the commercial catalogue designation alone\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Registry Number:\u003c\/strong\u003e\n No single CAS Registry Number should be assigned to the catalogue name without confirmation of the exact molecular identity; component-specific CAS numbers should be recorded where applicable\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n Batch-specific and dependent upon the exact amino-acid sequence, terminal structures, acetylation, additional modifications and counter-ion form\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMixture Formula Clarification:\u003c\/strong\u003e\n A two-component peptide mixture does not have one molecular formula; the formula of each component should be stated independently\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Weight:\u003c\/strong\u003e\n Batch-specific and dependent upon the exact molecular structure or component structures\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMixture Molecular-Weight Clarification:\u003c\/strong\u003e\n A two-component mixture does not have one component molecular weight; the calculated and measured mass of each peptide should be recorded independently\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Amino-Acid Sequence:\u003c\/strong\u003e\n Must be stated in the applicable completed Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComponent Sequences:\u003c\/strong\u003e\n Where supplied as a blend, the complete amino-acid sequence of every peptide component must be stated separately\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAcetylation Position:\u003c\/strong\u003e\n The residue or terminal group carrying the covalent acetyl modification must be identified\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAcetylation Stoichiometry:\u003c\/strong\u003e\n The number of covalently incorporated acetyl groups per peptide molecule must be stated\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAcetylation Clarification:\u003c\/strong\u003e\n Covalent acetylation must be distinguished from acetate acting as a salt-form counter-ion\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Batch-specific and to be stated in the applicable molecular-identity documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Batch-specific; the free carboxylic acid or amidated form must be identified\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAdditional Modified Residues:\u003c\/strong\u003e\n Any D-amino acids, 2-aminoisobutyric acid residues, non-proteinogenic residues or other substitutions must be declared\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eLipidation or Acylation:\u003c\/strong\u003e\n Any fatty-acid component, attachment site, linker and spacer structure must be stated where present\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eManufacturing Route:\u003c\/strong\u003e\n The material should only be described as synthetic, recombinant or semi-synthetic where that manufacturing route is supported by the supplier and batch-production records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRecombinant-Status Clarification:\u003c\/strong\u003e\n The phrase “recombinant peptide analogue” should not be used unless recombinant expression and subsequent purification are documented\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComponent Ratio:\u003c\/strong\u003e\n Required where the material contains more than one peptide component\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIndividual Component Quantity:\u003c\/strong\u003e\n The nominal or measured quantity of each peptide component should be stated separately\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTotal Nominal Vial Quantity:\u003c\/strong\u003e\n The product specification must state whether the declared vial amount represents total peptide content, one component, combined component content or total formulated material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material where confirmed by the applicable batch documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChromatographic Purity:\u003c\/strong\u003e\n The applicable high-performance liquid chromatography result, method, detection wavelength and acceptance criterion should be stated for the defined molecule or separately for each component\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic area percentage is not automatically equivalent to net peptide content, molecular identity or component ratio\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eBlend Quantification:\u003c\/strong\u003e\n A final chromatogram alone should not be used to infer component mass ratio unless the analytical method has validated response factors and suitable reference standards\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Identity:\u003c\/strong\u003e\n The measured mass should agree with the calculated mass of the defined peptide or with the individual calculated masses of every declared component\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Assay:\u003c\/strong\u003e\n Net peptide content should be measured or calculated separately from chromatographic purity\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComponent Assay:\u003c\/strong\u003e\n Where supplied as a blend, a validated quantitative method should confirm the amount or ratio of each peptide component\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify the free peptide, acetate-containing form, trifluoroacetate-containing form, sodium-containing form or other counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Content:\u003c\/strong\u003e\n Acetate, trifluoroacetate, sodium or another counter-ion may affect total supplied material mass and calculated net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water and hydration state may contribute to the total material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from synthesis, cleavage, modification, chromatographic purification, blending, concentration and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely acetylated material, incorrect terminal forms, unmodified components and other synthesis-related or process-related substances are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAdditional HPLC Purification:\u003c\/strong\u003e\n For a single-molecule ULTIMATE batch, the defined peptide undergoes the additional preparative purification stage; for a blend, each component should undergo the applicable additional purification before quantitative mixing\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eEndotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide method, result, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, buffer, concentration and mixing procedure should be selected using the exact sequence, composition, batch documentation and validated laboratory method\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eStorage Specification:\u003c\/strong\u003e\n Storage conditions should be taken from the applicable stability data and completed batch documentation rather than assigned solely from the catalogue name\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, sequence, terminal structure, covalent modification, chromatographic purity, net peptide content, component ratio, counter-ion content, water content, residual solvents and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n ✓ \u003cstrong\u003eCompleted batch documentation\u003c\/strong\u003e – The Certificate of Analysis should identify the exact single molecule or every component in the supplied preparation.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eMatching Safety Data Sheet\u003c\/strong\u003e – The Safety Data Sheet should use the same product identity, component description and chemical-form information as the applicable Certificate of Analysis.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSequence documentation\u003c\/strong\u003e – The complete amino-acid sequence or component sequences should be recorded.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eModification documentation\u003c\/strong\u003e – Acetylation position, terminal structures, modified residues, linkers and lipid components should be declared where applicable.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eComponent-ratio documentation\u003c\/strong\u003e – A multi-component preparation should state the individual quantity and quantitative ratio of each peptide.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eMass-spectrometry documentation\u003c\/strong\u003e – Molecular identity should be supported by analytical mass data consistent with the declared structure or structures.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eChromatographic documentation\u003c\/strong\u003e – High-performance liquid chromatography purity should be reported separately from peptide-content assay and blend-ratio determination.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003ePeptide-content documentation\u003c\/strong\u003e – Net peptide content should be distinguished from total vial mass, water, counter-ions and formulation components.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eChemical-form documentation\u003c\/strong\u003e – Acetate, trifluoroacetate, sodium or other counter-ion presentations should be identified clearly.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eEndotoxin documentation\u003c\/strong\u003e – The bacterial endotoxin or lipopolysaccharide method, suitability controls, units, acceptance criterion and result should be recorded.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSupplier documentation\u003c\/strong\u003e – Supporting synthesis or production, modification, purification, blending and analytical records should be reviewed where supplied.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eTrackable professional delivery\u003c\/strong\u003e – Securely packaged and dispatched using transport controls appropriate to the applicable batch stability and storage specification.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp style=\"color: #c00000; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor Research Use Only\u003c\/strong\u003e\n \u003cbr\u003e\n This product is supplied strictly for verified scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use, pharmacy compounding, self-administration or any form of therapeutic application.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"acetyl-glp-1-gip-product-overview\"\u003e\n \u003cstrong\u003eACETYL GLP-1 + GIP Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Our\n \u003cstrong\u003eACETYL GLP-1 + GIP research peptide preparation\u003c\/strong\u003e\n is supplied for controlled analytical method development, modified peptide identity assessment, high-performance liquid chromatography evaluation, liquid chromatography–mass spectrometry workflows, impurity profiling, quantitative composition assessment, reference-material comparison and other verified professional laboratory investigations.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The name ACETYL GLP-1 + GIP is a catalogue designation rather than a complete sequence-based chemical name. The applicable batch documentation must therefore establish whether the material consists of one sequence-defined modified peptide or a controlled preparation containing two separately characterised peptide components.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n For a single sequence-defined molecule, the complete amino-acid sequence, stereochemistry, terminal structures, acetylation position, additional residue substitutions, linker, lipidation and calculated molecular mass should be recorded. For a two-component preparation, the same information should be provided separately for each peptide together with the individual component quantities and declared blend ratio.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n No single CAS number, molecular formula or molecular weight should be assigned solely from the commercial product name. A multi-component preparation has component-specific molecular identities, while a single modified peptide requires its exact sequence and covalent structure before these identifiers can be established.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The material should be handled with a focus on batch traceability, documented molecular identity and consistent laboratory presentation. Product identity, complete sequence or component sequences, acetylation, terminal structures, chromatographic purity, net peptide content, component ratio, molecular form, counter-ion content, water content, residual solvents, bacterial endotoxin results and other analytical specifications should be confirmed using the applicable completed batch Certificate of Analysis.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net peptide content or quantitative blend composition. Different peptide components may produce different detector responses, so a chromatographic area ratio should only be treated as a mass ratio where the method has been validated for that purpose.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility, complete molecular identity, correct acetylation, component ratio or the absence of every peptide-related and process-related impurity. Any sterility claim must be supported separately by an appropriate validated sterility test and controlled production documentation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, peptide characterisation, reference-material evaluation and general laboratory work, the\n \u003cstrong\u003eRegular ACETYL GLP-1 + GIP specification remains highly suitable\u003c\/strong\u003e.\n The premium black-and-gold ULTIMATE option provides additional preparative high-performance liquid chromatography purification, enhanced identity and composition control, and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for projects requiring enhanced quality-control parameters.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Supply is restricted to verified commercial, institutional and academic laboratory organisations. This catalogue listing must not be interpreted as offering an authorised medicinal product or a preparation intended for personal use.\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP063.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP063.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"peptidestore","offers":[{"title":"5mg","offer_id":50256480338258,"sku":"PEP063","price":67.85,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50256480371026,"sku":"PEP063","price":117.95,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50256480403794,"sku":"PEP063","price":197.5,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50256480436562,"sku":"PEP063","price":358.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51241977348434,"sku":"PEP063","price":278.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51241978495314,"sku":"PEP063","price":487.25,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51241979380050,"sku":"PEP063","price":973.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51241980232018,"sku":"PEP063","price":973.5,"currency_code":"GBP","in_stock":true},{"title":"5mg Ultimate","offer_id":54670555742546,"sku":"PEP063U","price":84.5,"currency_code":"GBP","in_stock":true},{"title":"10mg Ultimate","offer_id":54670578876754,"sku":"PEP063U","price":175.25,"currency_code":"GBP","in_stock":true},{"title":"20mg Ultimate","offer_id":54670598799698,"sku":"PEP063U","price":256.95,"currency_code":"GBP","in_stock":true},{"title":"50mg Ultimate","offer_id":54670625440082,"sku":"PEP063U","price":428.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54766527643986,"sku":"PEP063U","price":403.25,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54766527676754,"sku":"PEP063U","price":706.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54766527709522,"sku":"PEP063U","price":1411.25,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766527742290,"sku":"PEP063U","price":1411.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-acetyl-glp-1-gip-peptide-ultra-pure-research-powder.png?v=1767865779"},{"product_id":"buy-b7-33-uk-research-grade-peptide","title":"B7-33 - Research Grade Peptide","description":"\u003ch3 id=\"b7-33-research-grade-single-chain-relaxin-peptide\"\u003e\n \u003cstrong\u003e\n B7-33\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, Helvetica, sans-serif;\"\u003e\n – Research-Grade 27-Residue Single-Chain Peptide\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n Research-grade, sequence-defined B7-33 single-chain peptide with batch documentation available where supplied\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Defined 27-residue sequence derived from positions 7–33 of the extended human relaxin-2 B-chain\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Contains serine substitutions corresponding to the native B-chain cysteine residues at positions 11 and 23\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n C-terminally amidated linear peptide containing no cysteine residues or disulphide bonds\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Batch identity, chromatographic purity, molecular mass, peptide content and analytical specifications stated in the applicable Certificate of Analysis\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Handled and supplied exclusively as a research-use laboratory material\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n B7-33 is a synthetic, single-chain peptide derived from the B-chain of human relaxin-2. The defined research peptide is more precisely described as B7-33 C11.23S because the cysteine residues corresponding to positions 11 and 23 of the native human relaxin-2 B-chain have been replaced by serine. The supplied structure contains a free N-terminal valine and a C-terminal leucinamide.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Each vial contains measured laboratory material prepared to support controlled scientific handling, storage, analytical method development, chromatographic assessment, mass-spectrometry evaluation and peptide characterisation. The stated nominal quantity refers to the declared B7-33 peptide content of one vial, subject to the applicable batch documentation and stated assay basis.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Where laboratory dissolution is required, the solvent, buffer, concentration, mixing procedure and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal bacteriostatic-water instruction should not be applied to every peptide batch, counter-ion form or laboratory preparation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Research Scientific Ltd does not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT B7-33 MOLECULAR IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 21px 23px;\n background: linear-gradient(135deg, #f8f8f8 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 9px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.5px;\n text-transform: uppercase;\n \"\u003e\n Important Molecular Identity Information\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 11px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n This PEP065 listing describes the modified B7-33 C11.23S peptide with the complete structure:\n \u003cstrong\u003e\n H-Val-Ile-Lys-Leu-Ser-Gly-Arg-Glu-Leu-Val-Arg-Ala-Gln-Ile-Ala-Ile-Ser-Gly-Met-Ser-Thr-Trp-Ser-Lys-Arg-Ser-Leu-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/strong\u003e.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 11px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n The sequence contains 27 amino-acid residues. The designation B7-33 refers to residues corresponding to positions 7 through 33 of the extended human relaxin-2 B-chain, inclusive. Descriptions that call this same sequence a 26-residue peptide are incorrect.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 11px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n The serine residues at positions 5 and 17 of the isolated 27-residue peptide correspond to cysteine positions 11 and 23 in the original human relaxin-2 B-chain numbering. These substitutions remove both cysteine residues from the B7-33 molecule.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n The molecular formula and molecular weight stated below describe the uncountered, C-terminally amidated peptide. Acetate, trifluoroacetate, residual water, solvents and formulation components should be recorded separately in the applicable batch documentation.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT B7-33 MOLECULAR IDENTITY NOTICE --\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-b7-33-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 34px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 38px 29px;\n background:\n linear-gradient(\n 135deg,\n #010101 0%,\n #080808 23%,\n #222222 53%,\n #101010 78%,\n #020202 100%\n );\n border: 1px solid #d4af37;\n border-radius: 18px;\n box-shadow:\n 0 24px 54px rgba(0, 0, 0, 0.40),\n 0 0 0 1px rgba(212, 175, 55, 0.10),\n inset 0 1px 0 rgba(255, 239, 170, 0.10),\n inset 0 0 38px rgba(212, 175, 55, 0.045);\n \"\u003e\n \u003c!-- DECORATIVE UPPER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -150px;\n right: -110px;\n width: 390px;\n height: 390px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 231, 145, 0.27) 0%,\n rgba(212, 175, 55, 0.13) 31%,\n rgba(212, 175, 55, 0.035) 53%,\n rgba(212, 175, 55, 0) 74%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE LOWER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -180px;\n left: -130px;\n width: 370px;\n height: 370px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.17) 0%,\n rgba(212, 175, 55, 0.055) 41%,\n rgba(212, 175, 55, 0) 74%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE GOLD TOP EDGE --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.82) 24%,\n rgba(255, 240, 176, 1) 50%,\n rgba(247, 223, 136, 0.82) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.16),\n rgba(212, 175, 55, 0.05)\n );\n border: 1px solid rgba(247, 223, 136, 0.74);\n border-radius: 999px;\n box-shadow:\n 0 6px 16px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.07);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-b7-33-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 19px rgba(212, 175, 55, 0.25),\n 0 1px 0 rgba(255, 255, 255, 0.10);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n B7-33\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 9px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.8px;\n text-transform: uppercase;\n \"\u003e\n Additional Preparative HPLC Purification and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 12px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.72;\n letter-spacing: 0.1px;\n \"\u003e\n A premium laboratory specification incorporating an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for demanding analytical research workflows.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 26px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.74) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.74) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE B7-33 range\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of peptide purification and batch quality control. Following the standard synthesis and purification process, the finished B7-33 research material undergoes an additional preparative high-performance liquid chromatography purification stage.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n This supplementary chromatographic stage is intended to reduce further the level of chromatographically separable deletion sequences, truncated peptides, incompletely deprotected material, terminally incorrect structures, oxidation products and other synthesis-related or process-related impurities.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n ULTIMATE batches are also assessed against a more stringent bacterial endotoxin or lipopolysaccharide specification than the Regular range. The applicable analytical method, reporting units, method-suitability controls, acceptance criterion and final batch result should be recorded in the corresponding Certificate of Analysis.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 29px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 21px;\n background:\n linear-gradient(\n 145deg,\n rgba(36, 36, 36, 0.98),\n rgba(7, 7, 7, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.46);\n border-radius: 11px;\n box-shadow:\n 0 10px 24px rgba(0, 0, 0, 0.27),\n inset 0 1px 0 rgba(255, 255, 255, 0.035);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional HPLC Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.65;\n \"\u003e\n A further preparative high-performance liquid chromatography purification stage is completed after the standard B7-33 synthesis and purification workflow.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED MOLECULAR IDENTITY CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 21px;\n background:\n linear-gradient(\n 145deg,\n rgba(36, 36, 36, 0.98),\n rgba(7, 7, 7, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.46);\n border-radius: 11px;\n box-shadow:\n 0 10px 24px rgba(0, 0, 0, 0.27),\n inset 0 1px 0 rgba(255, 255, 255, 0.035);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Sequence and Mass Confirmation\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.65;\n \"\u003e\n Supporting batch documentation should confirm the 27-residue B7-33 C11.23S sequence, C-terminal amide and molecular mass consistent with the declared structure.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 21px;\n background:\n linear-gradient(\n 145deg,\n rgba(36, 36, 36, 0.98),\n rgba(7, 7, 7, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.46);\n border-radius: 11px;\n box-shadow:\n 0 10px 24px rgba(0, 0, 0, 0.27),\n inset 0 1px 0 rgba(255, 255, 255, 0.035);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.65;\n \"\u003e\n The final batch is assessed against the enhanced ULTIMATE bacterial endotoxin or lipopolysaccharide specification using an appropriate product-specific method-suitability assessment.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 21px 23px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.065),\n rgba(255, 255, 255, 0.026)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.085);\n border-right: 1px solid rgba(255, 255, 255, 0.085);\n border-bottom: 1px solid rgba(255, 255, 255, 0.085);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.014),\n 0 7px 17px rgba(0, 0, 0, 0.14);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.75;\n \"\u003e\n For the majority of routine analytical method development, chromatographic assessment, liquid chromatography–mass spectrometry comparison, peptide characterisation, reference-material evaluation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade B7-33 product remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where the additional preparative high-performance liquid chromatography purification stage and more stringent bacterial endotoxin or lipopolysaccharide specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.65;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE B7-33 remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use or therapeutic application. Molecular identity, complete sequence, Cys-to-Ser substitutions, C-terminal amidation, chromatographic purity, net peptide content, molecular form, counter-ion content, residual solvents, water content, methionine oxidation and bacterial endotoxin results are batch-specific and should be confirmed using the applicable completed Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"b7-33-chemical-and-structural-information\"\u003e\n \u003cstrong\u003eChemical and Structural Information:\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n B7-33\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Technical Description:\u003c\/strong\u003e\n Modified B7-33 C11.23S human relaxin-2 B-chain analogue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Scientific Designations:\u003c\/strong\u003e\n B7-33 C11.23S; modified B7-33; single-chain relaxin-2 B-chain analogue; H2 relaxin B-chain 7–33 C11.23S\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic sequence-defined linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 27 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Peptide Sequence:\u003c\/strong\u003e\n H-Val-Ile-Lys-Leu-Ser-Gly-Arg-Glu-Leu-Val-Arg-Ala-Gln-Ile-Ala-Ile-Ser-Gly-Met-Ser-Thr-Trp-Ser-Lys-Arg-Ser-Leu-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n VIKLSGRELVRAQIAISGMSTWSKRSL-NH\u003csub\u003e2\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eB-Chain Numbering:\u003c\/strong\u003e\n Corresponds to positions 7–33 of the extended human relaxin-2 B-chain\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNative B-Chain Cysteine Substitutions:\u003c\/strong\u003e\n Cys\u003csup\u003eB11\u003c\/sup\u003e→Ser and Cys\u003csup\u003eB23\u003c\/sup\u003e→Ser\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePositions Within the Isolated B7-33 Sequence:\u003c\/strong\u003e\n The substituted serine residues occur at positions 5 and 17 of the 27-residue peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free L-valine amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n C-terminal L-leucinamide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Structure:\u003c\/strong\u003e\n Linear single-chain peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None; both native relaxin-2 B-chain cysteine positions are occupied by serine in the defined B7-33 C11.23S structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMethionine Content:\u003c\/strong\u003e\n One methionine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSulphur Content:\u003c\/strong\u003e\n One sulphur atom contributed by the methionine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 1818415-56-3\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 162662592\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e131\u003c\/sub\u003eH\u003csub\u003e229\u003c\/sub\u003eN\u003csub\u003e41\u003c\/sub\u003eO\u003csub\u003e36\u003c\/sub\u003eS\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 2986.58 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eApproximate Molecular Size:\u003c\/strong\u003e\n 2.99 kDa\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCalculated Monoisotopic Mass:\u003c\/strong\u003e\n Approximately 2984.7070 Da\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The molecular formula and molecular weight describe the uncountered, C-terminally amidated B7-33 C11.23S peptide without acetate, trifluoroacetate, residual water, solvents or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eHuman Relaxin-2 Distinction:\u003c\/strong\u003e\n B7-33 is a single B-chain-derived peptide and is not chemically identical to the complete two-chain human relaxin-2 molecule\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNative B7-33 Distinction:\u003c\/strong\u003e\n The unmodified B7-33 sequence containing cysteine at the corresponding B11 and B23 positions is a different molecular structure from the C11.23S peptide described on this page\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminally Acetylated Analogue Distinction:\u003c\/strong\u003e\n Ac-B7-33 C11.23S contains an additional covalent N-terminal acetyl modification and is a separate molecular structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry powder or lyophilised laboratory material, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material where confirmed by the applicable batch documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChromatographic Purity:\u003c\/strong\u003e\n The applicable high-performance liquid chromatography result, analytical method and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePurity Interpretation:\u003c\/strong\u003e\n Chromatographic area percentage represents relative chromatographic composition under the stated analytical conditions and does not, by itself, establish molecular identity or net peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePeptide-Content Specification:\u003c\/strong\u003e\n Net B7-33 peptide content should be distinguished from chromatographic purity and interpreted alongside counter-ion content, water content, residual solvents and formulation components\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eNominal Amount Basis:\u003c\/strong\u003e\n The applicable product specification should state whether the declared vial quantity is expressed as anhydrous parent-peptide equivalent or as total supplied salt-form or formulated material\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Confirmation:\u003c\/strong\u003e\n The complete 27-residue sequence should be confirmed using the applicable supplier, synthesis and batch records\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSubstitution Confirmation:\u003c\/strong\u003e\n The two intended Cys-to-Ser substitutions should be supported by the sequence record and appropriate molecular-identity documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Amidation Confirmation:\u003c\/strong\u003e\n Molecular-identity documentation should confirm the C-terminal leucinamide and distinguish it from the corresponding free carboxylic acid structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMass-Spectrometry Confirmation:\u003c\/strong\u003e\n The observed molecular mass should be consistent with the complete, C-terminally amidated B7-33 C11.23S structure\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eChemical-Form Confirmation:\u003c\/strong\u003e\n The applicable Certificate of Analysis should identify whether the supplied material is the uncountered peptide, an acetate-containing form, a trifluoroacetate-containing form or another counter-ion presentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCounter-Ion Specification:\u003c\/strong\u003e\n Acetate, trifluoroacetate or another counter-ion may affect total supplied material mass and calculated net B7-33 peptide content\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eWater-Content Specification:\u003c\/strong\u003e\n Residual water and hydration state may contribute to the total material mass and should be stated or controlled through the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eResidual-Solvent Specification:\u003c\/strong\u003e\n Applicable residual solvents arising from synthesis, cleavage, purification, concentration and lyophilisation should be stated or controlled through the batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMethionine-Oxidation Control:\u003c\/strong\u003e\n Methionine sulfoxide and other oxidation products should be assessed or controlled where required by the applicable batch specification\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eRelated-Impurity Control:\u003c\/strong\u003e\n Deletion sequences, truncated peptides, incompletely amidated material, incompletely deprotected material, unmodified cysteine-containing sequences and other synthesis-related or process-related substances are separate quality attributes\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDissolution Method:\u003c\/strong\u003e\n The appropriate solvent, buffer, concentration and mixing procedure should be selected using the exact chemical form, applicable batch documentation and validated laboratory method\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eBacterial Endotoxin Specification:\u003c\/strong\u003e\n The applicable bacterial endotoxin or lipopolysaccharide result, analytical method, reporting units, method-suitability controls and acceptance criterion should be stated in the batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSterility Distinction:\u003c\/strong\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility. Sterility should only be claimed where supported by an appropriate validated sterility test and controlled filling process\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Molecular identity, complete sequence, substitution pattern, terminal amidation, chromatographic purity, net peptide content, counter-ion content, water content, residual solvents, oxidation products and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n ✓ \u003cstrong\u003eBatch documentation\u003c\/strong\u003e – Completed Certificate of Analysis documentation is provided where supplied for the applicable batch.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSequence documentation\u003c\/strong\u003e – The complete 27-residue VIKLSGRELVRAQIAISGMSTWSKRSL-NH\u003csub\u003e2\u003c\/sub\u003e sequence should be recorded.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSubstitution documentation\u003c\/strong\u003e – The Cys\u003csup\u003eB11\u003c\/sup\u003e→Ser and Cys\u003csup\u003eB23\u003c\/sup\u003e→Ser substitutions should be supported by the applicable synthesis records.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eC-terminal modification documentation\u003c\/strong\u003e – C-terminal leucinamide should be confirmed and distinguished from the corresponding free-acid structure.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eMass-spectrometry documentation\u003c\/strong\u003e – Molecular identity should be supported by analytical mass data consistent with the specified B7-33 structure.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eChromatographic documentation\u003c\/strong\u003e – High-performance liquid chromatography purity should be reported separately from molecular identity and net peptide content.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003ePeptide-content documentation\u003c\/strong\u003e – Net B7-33 content should be distinguished from total vial mass, residual water, counter-ions and formulation components.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eChemical-form documentation\u003c\/strong\u003e – Acetate, trifluoroacetate or another counter-ion should be identified where present.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eOxidation-control documentation\u003c\/strong\u003e – Methionine oxidation should be assessed or controlled where required by the applicable research specification.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eBacterial endotoxin documentation\u003c\/strong\u003e – The method, reporting units, suitability controls, acceptance criterion and batch result should be recorded.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSafety Data Sheet\u003c\/strong\u003e – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eSupplier documentation\u003c\/strong\u003e – Reviewed where supporting synthesis, purification and analytical records are supplied.\n \u003cbr\u003e\n\n ✓ \u003cstrong\u003eTrackable laboratory delivery\u003c\/strong\u003e – Securely packaged and dispatched using transport controls appropriate to the applicable batch stability and storage specification.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp style=\"color: #c00000; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor Research Use Only\u003c\/strong\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use or any form of therapeutic application.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"b7-33-product-overview\"\u003e\n \u003cstrong\u003eB7-33 Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Our\n \u003cstrong\u003eB7-33 research-grade single-chain peptide\u003c\/strong\u003e\n is supplied for controlled analytical method development, peptide identity assessment, high-performance liquid chromatography evaluation, liquid chromatography–mass spectrometry workflows, impurity profiling, reference-material comparison and other scientific laboratory investigations.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The PEP065 molecular identity comprises a defined 27-residue sequence derived from positions 7–33 of the extended human relaxin-2 B-chain. The cysteine residues corresponding to B-chain positions 11 and 23 are replaced by serine, producing the sequence VIKLSGRELVRAQIAISGMSTWSKRSL-NH\u003csub\u003e2\u003c\/sub\u003e.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The molecule has a free N-terminal valine and a C-terminal leucinamide. It contains no cysteine residues and therefore has no intramolecular or intermolecular disulphide bonds. Its single sulphur atom is contributed by the methionine residue within the sequence.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n CAS number 1818415-56-3, molecular formula C\u003csub\u003e131\u003c\/sub\u003eH\u003csub\u003e229\u003c\/sub\u003eN\u003csub\u003e41\u003c\/sub\u003eO\u003csub\u003e36\u003c\/sub\u003eS and average molecular weight approximately 2986.58 g\/mol describe the uncountered, C-terminally amidated B7-33 C11.23S molecule. Where the supplied material contains acetate, trifluoroacetate, residual water, solvents or formulation components, the applicable batch documentation should identify their contribution to the total supplied material mass.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n B7-33 should not be confused with complete two-chain human relaxin-2, the cysteine-containing native B7-33 sequence, N-terminally acetylated B7-33 derivatives or shorter minimal-sequence analogues. Those materials have different molecular structures, molecular masses and analytical acceptance criteria.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net B7-33 peptide content or proof of the complete sequence and terminal structure. Molecular identity should be assessed using the applicable combination of sequence documentation, high-performance liquid chromatography, mass spectrometry, peptide-content analysis and batch-production records.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility, complete molecular identity, correct substitution pattern, terminal amidation or the absence of every peptide-related and process-related impurity.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, impurity profiling, peptide characterisation and general laboratory work, the\n \u003cstrong\u003eRegular B7-33 specification remains highly suitable\u003c\/strong\u003e.\n The premium black-and-gold ULTIMATE B7-33 option provides an additional preparative high-performance liquid chromatography purification stage and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for projects requiring enhanced quality-control parameters.\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP065.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP065.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Nupex","offers":[{"title":"5mg","offer_id":50256481190226,"sku":"PEP065","price":39.95,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50256481222994,"sku":"PEP065","price":69.85,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50256481255762,"sku":"PEP065","price":113.25,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50256481288530,"sku":"PEP065","price":209.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51242115629394,"sku":"PEP065","price":163.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51242121560402,"sku":"PEP065","price":325.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51242125558098,"sku":"PEP065","price":284.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51242126868818,"sku":"PEP065","price":568.5,"currency_code":"GBP","in_stock":true},{"title":"5mg Ultimate","offer_id":54670389576018,"sku":"PEP065U","price":52.5,"currency_code":"GBP","in_stock":true},{"title":"10mg Ultimate","offer_id":54670421852498,"sku":"PEP065U","price":98.85,"currency_code":"GBP","in_stock":true},{"title":"20mg Ultimate","offer_id":54670481850706,"sku":"PEP065U","price":148.5,"currency_code":"GBP","in_stock":true},{"title":"50mg Ultimate","offer_id":54670497710418,"sku":"PEP065U","price":278.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54766581514578,"sku":"PEP065U","price":236.5,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54766581547346,"sku":"PEP065U","price":471.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54766581580114,"sku":"PEP065U","price":412.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766581612882,"sku":"PEP065U","price":824.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-buy-b7-33-uk-ultra-pure-research-grade-peptide-powder.png?v=1767865779"},{"product_id":"bpc-157-tb500-blend-uk","title":"BPC-157 \u0026 TB500 BLEND - Research Grade Peptide","description":"\u003ch3 id=\"bpc-157-tb500-full-length-thymosin-beta-4-blend\"\u003e\n \u003cstrong\u003e\n BPC-157 \u0026amp; TB500 Blend\n \u003cspan style=\"font-size: 12pt; line-height: 115%; font-family: Arial, Helvetica, sans-serif;\"\u003e\n – Research-Grade Dual-Peptide Blend\n \u003c\/span\u003e\n \u003c\/strong\u003e\n\u003c\/h3\u003e\n \u003cp style=\"margin: 0 0 20px; padding: 16px 18px; color: #c00000; background-color: #fff5f5; border: 1px solid #f0c7c7; border-left: 4px solid #c00000; font-size: 14px; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor research purposes only.\u003c\/strong\u003e\n This product is supplied exclusively for scientific laboratory research and analytical\n purposes. It is not intended for human or animal use, consumption, clinical use or\n therapeutic application. It must not be used in any way that contravenes applicable\n laws or the requirements of the Medicines and Healthcare products Regulatory Agency.\n \u003c\/p\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003e\n Defined two-component blend containing BPC-157 and full-length thymosin beta-4\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Formulated at a 1:1 ratio by declared peptide mass unless a product variant expressly states otherwise\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n TB500 component defined as full-length 43-residue thymosin beta-4 or timbetasin\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Supplied as measured dry or lyophilised laboratory material in sealed flip-top headspace vials\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Component identity, chromatographic purity, molecular mass and blend composition documented in the applicable completed Certificate of Analysis where supplied\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003e\n Handled and supplied exclusively as a research-use laboratory preparation\n \u003c\/strong\u003e\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n PEP066 is a defined physical mixture of two separate peptide substances: BPC-157 and full-length thymosin beta-4. The two components remain chemically distinct within the preparation and do not form a new single peptide molecule merely because they are blended in the same vial.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Unless the selected product variant states otherwise, BPC-157 and full-length thymosin beta-4 are included in equal quantities by declared peptide mass. For example, a vial described as containing 20 mg total peptide contains a nominal 10 mg of BPC-157 and 10 mg of full-length thymosin beta-4. The total physical powder mass may be greater where a declared carrier, bulking agent or other formulation excipient is present.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n A 1:1 mass ratio is not the same as a 1:1 molar ratio because the two components have substantially different molecular weights. Product documentation should therefore describe the blend as equal by peptide mass rather than equimolar.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Where laboratory dissolution is required, the solvent, buffer, concentration, mixing procedure, material-compatibility controls and storage conditions stated in the applicable Certificate of Analysis, Safety Data Sheet or validated laboratory method should be followed. A universal solvent instruction should not be applied to every peptide blend, counter-ion form or formulated preparation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n Research Scientific Ltd does not provide advice or recommendations concerning dosage, administration or use in humans or animals.\n\u003c\/p\u003e\n\n\u003c!-- IMPORTANT TB500 COMPONENT IDENTITY NOTICE --\u003e\n\u003cdiv style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 24px 0;\n padding: 21px 23px;\n background: linear-gradient(135deg, #f8f8f8 0%, #eeeeee 100%);\n border: 1px solid #b8b8b8;\n border-left: 5px solid #333333;\n border-radius: 9px;\n box-shadow: 0 7px 18px rgba(0, 0, 0, 0.07);\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n margin: 0 0 9px;\n color: #111111;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.5px;\n text-transform: uppercase;\n \"\u003e\n Important TB500 Component Identity\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0 0 11px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n For this PEP066 product, the designation\n \u003cstrong\u003eTB500\u003c\/strong\u003e\n refers specifically to\n \u003cstrong\u003efull-length thymosin beta-4 or timbetasin\u003c\/strong\u003e,\n comprising 43 amino-acid residues with covalent N-terminal acetylation.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0 0 11px;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n The full-length component is identified by CAS number\n \u003cstrong\u003e77591-33-4\u003c\/strong\u003e,\n molecular formula\n \u003cstrong\u003eC\u003csub\u003e212\u003c\/sub\u003eH\u003csub\u003e350\u003c\/sub\u003eN\u003csub\u003e56\u003c\/sub\u003eO\u003csub\u003e78\u003c\/sub\u003eS\u003c\/strong\u003e\n and an average molecular weight of approximately\n \u003cstrong\u003e4963.5 g\/mol\u003c\/strong\u003e.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #333333;\n font-size: 14px;\n line-height: 1.72;\n \"\u003e\n The applicable supplier documentation and mass-spectrometry result should confirm the full-length molecular identity. This product description must not be used where the supplied TB500 component is a shorter thymosin-derived fragment or another molecular structure.\n \u003c\/p\u003e\n\u003c\/div\u003e\n\u003c!-- END IMPORTANT TB500 COMPONENT IDENTITY NOTICE --\u003e\n\n\u003ch3 id=\"bpc-157-tb500-blend-composition\"\u003e\n \u003cstrong\u003eDeclared Blend Composition\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.72;\"\u003e\n The following composition applies where the product variant is formulated at the standard 1:1 ratio by declared peptide mass. Each Laboratory Pack vial follows the composition of its stated individual vial strength.\n\u003c\/p\u003e\n\n\u003cdiv style=\"width: 100%; overflow-x: auto; margin: 18px 0 24px;\"\u003e\n \u003ctable style=\"\n width: 100%;\n min-width: 620px;\n border-collapse: collapse;\n font-family: Arial, Helvetica, sans-serif;\n font-size: 14px;\n color: #222222;\n background: #ffffff;\n border: 1px solid #c9c9c9;\n \"\u003e\n \u003cthead\u003e\n \u003ctr style=\"background: #202020; color: #ffffff;\"\u003e\n \u003cth scope=\"col\" style=\"\n padding: 13px 15px;\n text-align: left;\n border: 1px solid #444444;\n \"\u003e\n Nominal Variant\n \u003c\/th\u003e\n\n \u003cth scope=\"col\" style=\"\n padding: 13px 15px;\n text-align: left;\n border: 1px solid #444444;\n \"\u003e\n Total Declared Peptide\n \u003c\/th\u003e\n\n \u003cth scope=\"col\" style=\"\n padding: 13px 15px;\n text-align: left;\n border: 1px solid #444444;\n \"\u003e\n BPC-157\n \u003c\/th\u003e\n\n \u003cth scope=\"col\" style=\"\n padding: 13px 15px;\n text-align: left;\n border: 1px solid #444444;\n \"\u003e\n Full-Length Thymosin Beta-4\n \u003c\/th\u003e\n \u003c\/tr\u003e\n \u003c\/thead\u003e\n\n \u003ctbody\u003e\n \u003ctr\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 5 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 5 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 2.5 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 2.5 mg\n \u003c\/td\u003e\n \u003c\/tr\u003e\n\n \u003ctr style=\"background: #f7f7f7;\"\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 10 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 10 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 5 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 5 mg\n \u003c\/td\u003e\n \u003c\/tr\u003e\n\n \u003ctr\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 20 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 20 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 10 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 10 mg\n \u003c\/td\u003e\n \u003c\/tr\u003e\n\n \u003ctr style=\"background: #f7f7f7;\"\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 50 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 50 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 25 mg\n \u003c\/td\u003e\n \u003ctd style=\"padding: 12px 15px; border: 1px solid #d5d5d5;\"\u003e\n 25 mg\n \u003c\/td\u003e\n \u003c\/tr\u003e\n \u003c\/tbody\u003e\n \u003c\/table\u003e\n\u003c\/div\u003e\n\n\u003cp style=\"\n margin: 0 0 24px;\n padding: 15px 17px;\n color: #333333;\n background: #f4f4f4;\n border-left: 4px solid #777777;\n border-radius: 5px;\n font-size: 13px;\n line-height: 1.68;\n \"\u003e\n \u003cstrong\u003eComposition note:\u003c\/strong\u003e\n The values above describe nominal peptide content rather than total powder fill mass. Any carrier, bulking agent, counter-ion, residual water or other declared formulation component should be identified separately in the applicable batch documentation.\n\u003c\/p\u003e\n\n\u003c!-- ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\u003csection aria-labelledby=\"ultimate-bpc-157-tb500-blend-heading\" style=\"\n box-sizing: border-box;\n width: 100%;\n margin: 34px 0;\n font-family: Arial, Helvetica, sans-serif;\n \"\u003e\n \u003cdiv style=\"\n position: relative;\n overflow: hidden;\n box-sizing: border-box;\n width: 100%;\n padding: 38px 29px;\n background:\n linear-gradient(\n 135deg,\n #010101 0%,\n #080808 23%,\n #222222 53%,\n #101010 78%,\n #020202 100%\n );\n border: 1px solid #d4af37;\n border-radius: 18px;\n box-shadow:\n 0 24px 54px rgba(0, 0, 0, 0.40),\n 0 0 0 1px rgba(212, 175, 55, 0.10),\n inset 0 1px 0 rgba(255, 239, 170, 0.10),\n inset 0 0 38px rgba(212, 175, 55, 0.045);\n \"\u003e\n \u003c!-- DECORATIVE UPPER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: -150px;\n right: -110px;\n width: 390px;\n height: 390px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(255, 231, 145, 0.27) 0%,\n rgba(212, 175, 55, 0.13) 31%,\n rgba(212, 175, 55, 0.035) 53%,\n rgba(212, 175, 55, 0) 74%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE LOWER GOLD GLOW --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n bottom: -180px;\n left: -130px;\n width: 370px;\n height: 370px;\n border-radius: 50%;\n background:\n radial-gradient(\n circle,\n rgba(212, 175, 55, 0.17) 0%,\n rgba(212, 175, 55, 0.055) 41%,\n rgba(212, 175, 55, 0) 74%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003c!-- DECORATIVE GOLD TOP EDGE --\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n position: absolute;\n top: 0;\n left: 7%;\n width: 86%;\n height: 2px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(247, 223, 136, 0.82) 24%,\n rgba(255, 240, 176, 1) 50%,\n rgba(247, 223, 136, 0.82) 76%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"position: relative; z-index: 1;\"\u003e\n \u003cdiv style=\"\n display: inline-block;\n margin: 0 0 18px;\n padding: 8px 15px;\n color: #f7df88;\n background:\n linear-gradient(\n 135deg,\n rgba(212, 175, 55, 0.16),\n rgba(212, 175, 55, 0.05)\n );\n border: 1px solid rgba(247, 223, 136, 0.74);\n border-radius: 999px;\n box-shadow:\n 0 6px 16px rgba(0, 0, 0, 0.25),\n inset 0 1px 0 rgba(255, 255, 255, 0.07);\n font-size: 11px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 1.8px;\n text-transform: uppercase;\n \"\u003e\n Premium ULTIMATE Laboratory Specification\n \u003c\/div\u003e\n\n \u003ch2 id=\"ultimate-bpc-157-tb500-blend-heading\" style=\"\n margin: 0;\n color: #ffffff;\n font-size: 30px;\n font-weight: 700;\n line-height: 1.2;\n letter-spacing: 0.3px;\n overflow-wrap: anywhere;\n \"\u003e\n \u003cspan style=\"\n color: #f4d978;\n text-shadow:\n 0 0 19px rgba(212, 175, 55, 0.25),\n 0 1px 0 rgba(255, 255, 255, 0.10);\n \"\u003e\n ULTIMATE\n \u003c\/span\u003e\n\n BPC-157 \u0026amp; TB500 BLEND\n \u003c\/h2\u003e\n\n \u003cp style=\"\n margin: 9px 0 0;\n color: #f0d77d;\n font-size: 13px;\n font-weight: 700;\n line-height: 1.5;\n letter-spacing: 0.8px;\n text-transform: uppercase;\n \"\u003e\n Additional Preparative HPLC Purification, Controlled 1:1 Mass Blending and More Stringent LPS Testing\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 12px 0 0;\n color: #d8d8d8;\n font-size: 15px;\n line-height: 1.72;\n letter-spacing: 0.1px;\n \"\u003e\n A premium laboratory specification incorporating additional preparative high-performance liquid chromatography purification for each peptide component, controlled quantitative blending and a more stringent bacterial endotoxin or lipopolysaccharide testing specification.\n \u003c\/p\u003e\n\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 100%;\n height: 1px;\n margin: 26px 0;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0) 0%,\n rgba(212, 175, 55, 0.74) 16%,\n rgba(247, 223, 136, 1) 50%,\n rgba(212, 175, 55, 0.74) 84%,\n rgba(212, 175, 55, 0) 100%\n );\n \"\u003e\u003c\/div\u003e\n\n \u003cp style=\"\n margin: 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n The\n \u003cstrong style=\"color: #f7df88;\"\u003e\n ULTIMATE BPC-157 \u0026amp; TB500 Blend\n \u003c\/strong\u003e\n is our premium research specification for laboratories requiring an enhanced level of component purification, blend-composition control and batch quality assurance. Before controlled blending, both BPC-157 and full-length thymosin beta-4 undergo an additional preparative high-performance liquid chromatography purification stage following their standard synthesis and purification processes.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n This additional component-level purification is designed to reduce further the level of chromatographically separable deletion sequences, truncated peptides, incompletely deprotected material, oxidation products and other synthesis-related or process-related impurities. The purified components are subsequently combined in the defined 1:1 ratio by declared peptide mass.\n \u003c\/p\u003e\n\n \u003cp style=\"\n margin: 17px 0 0;\n color: #f1f1f1;\n font-size: 15px;\n line-height: 1.82;\n \"\u003e\n The completed ULTIMATE blend is also assessed against a more stringent bacterial endotoxin or lipopolysaccharide release specification than the Regular range. The analytical method, reporting units, method-suitability controls, acceptance criterion and final batch result should be recorded in the corresponding Certificate of Analysis where supplied.\n \u003c\/p\u003e\n\n \u003cdiv style=\"\n display: flex;\n flex-wrap: wrap;\n gap: 14px;\n width: 100%;\n margin: 29px 0;\n \"\u003e\n \u003c!-- ADDITIONAL HPLC PURIFICATION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 21px;\n background:\n linear-gradient(\n 145deg,\n rgba(36, 36, 36, 0.98),\n rgba(7, 7, 7, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.46);\n border-radius: 11px;\n box-shadow:\n 0 10px 24px rgba(0, 0, 0, 0.27),\n inset 0 1px 0 rgba(255, 255, 255, 0.035);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Additional Component Purification\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.65;\n \"\u003e\n BPC-157 and full-length thymosin beta-4 each undergo an additional preparative high-performance liquid chromatography purification stage before blending.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- CONTROLLED COMPOSITION CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 21px;\n background:\n linear-gradient(\n 145deg,\n rgba(36, 36, 36, 0.98),\n rgba(7, 7, 7, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.46);\n border-radius: 11px;\n box-shadow:\n 0 10px 24px rgba(0, 0, 0, 0.27),\n inset 0 1px 0 rgba(255, 255, 255, 0.035);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n Controlled 1:1 Mass Composition\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.65;\n \"\u003e\n The separately purified components are quantitatively combined in equal amounts by declared peptide mass, with the intended composition documented for the applicable batch.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- ENHANCED ENDOTOXIN TESTING CARD --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n flex: 1 1 210px;\n min-width: 0;\n padding: 21px;\n background:\n linear-gradient(\n 145deg,\n rgba(36, 36, 36, 0.98),\n rgba(7, 7, 7, 0.99)\n );\n border: 1px solid rgba(212, 175, 55, 0.46);\n border-radius: 11px;\n box-shadow:\n 0 10px 24px rgba(0, 0, 0, 0.27),\n inset 0 1px 0 rgba(255, 255, 255, 0.035);\n \"\u003e\n \u003cdiv aria-hidden=\"true\" style=\"\n width: 36px;\n height: 3px;\n margin: 0 0 13px;\n background:\n linear-gradient(\n 90deg,\n #b8860b,\n #f7df88,\n #d4af37\n );\n border-radius: 3px;\n \"\u003e\u003c\/div\u003e\n\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #d4af37;\n font-size: 12px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 1px;\n text-transform: uppercase;\n \"\u003e\n More Stringent LPS Testing\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #dddddd;\n font-size: 13px;\n line-height: 1.65;\n \"\u003e\n The final preparation is assessed against the enhanced ULTIMATE bacterial endotoxin or lipopolysaccharide specification using an applicable product-specific method-suitability assessment.\n \u003c\/div\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003c!-- REGULAR VERSUS ULTIMATE COMPARISON --\u003e\n \u003cdiv style=\"\n box-sizing: border-box;\n padding: 21px 23px;\n background:\n linear-gradient(\n 90deg,\n rgba(212, 175, 55, 0.065),\n rgba(255, 255, 255, 0.026)\n );\n border-top: 1px solid rgba(255, 255, 255, 0.085);\n border-right: 1px solid rgba(255, 255, 255, 0.085);\n border-bottom: 1px solid rgba(255, 255, 255, 0.085);\n border-left: 4px solid #d4af37;\n border-radius: 8px;\n box-shadow:\n inset 0 0 20px rgba(255, 255, 255, 0.014),\n 0 7px 17px rgba(0, 0, 0, 0.14);\n \"\u003e\n \u003cdiv style=\"\n margin-bottom: 8px;\n color: #f7df88;\n font-size: 14px;\n font-weight: 700;\n line-height: 1.4;\n letter-spacing: 0.2px;\n \"\u003e\n Regular or ULTIMATE?\n \u003c\/div\u003e\n\n \u003cdiv style=\"\n color: #e5e5e5;\n font-size: 14px;\n line-height: 1.75;\n \"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, blend-characterisation, reference-material evaluation and general laboratory work, our\n \u003cstrong style=\"color: #ffffff;\"\u003e\n Regular research-grade BPC-157 \u0026amp; TB500 Blend remains highly suitable\n \u003c\/strong\u003e\n and provides an appropriate balance of peptide quality, batch documentation and value. The ULTIMATE option is intended for scientific projects where additional component-level preparative high-performance liquid chromatography purification and a more stringent bacterial endotoxin or lipopolysaccharide specification are specifically required.\n \u003c\/div\u003e\n \u003c\/div\u003e\n\n \u003cp style=\"\n margin: 20px 0 0;\n color: #aaaaaa;\n font-size: 11px;\n line-height: 1.65;\n letter-spacing: 0.2px;\n \"\u003e\n ULTIMATE BPC-157 \u0026amp; TB500 Blend remains strictly for scientific laboratory research and analytical use only. It is not intended for human or animal use, clinical use, diagnostic use, pharmacy compounding, self-administration or therapeutic application. Component identity, complete sequences, terminal structures, chromatographic purity, individual peptide content, blend ratio, counter-ion content, residual solvents, water content, bacterial endotoxin results and other analytical specifications are batch-specific and should be confirmed using the applicable completed Certificate of Analysis. Bacterial endotoxin or lipopolysaccharide testing does not constitute sterility testing.\n \u003c\/p\u003e\n \u003c\/div\u003e\n \u003c\/div\u003e\n\u003c\/section\u003e\n\u003c!-- END ULTIMATE PREMIUM PRODUCT SECTION --\u003e\n\n\u003ch3 id=\"bpc-157-tb500-blend-level-information\"\u003e\n \u003cstrong\u003eBlend-Level Chemical and Composition Information\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eProduct Name:\u003c\/strong\u003e\n BPC-157 \u0026amp; TB500 Blend\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCatalogue Product Identifier:\u003c\/strong\u003e\n PEP066\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Technical Description:\u003c\/strong\u003e\n Defined BPC-157 and full-length thymosin beta-4 dual-peptide mixture\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eProduct Type:\u003c\/strong\u003e\n Physical mixture of two separate sequence-defined peptide substances\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDeclared Standard Ratio:\u003c\/strong\u003e\n 1:1 by peptide mass unless the selected product variant expressly states otherwise\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolar-Ratio Clarification:\u003c\/strong\u003e\n Equal component masses do not produce equal molar quantities because BPC-157 and full-length thymosin beta-4 have different molecular weights\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSingle Blend CAS Registry Number:\u003c\/strong\u003e\n Not applicable; the component CAS numbers should be recorded separately\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSingle Blend Molecular Formula:\u003c\/strong\u003e\n Not applicable; the component molecular formulae should be recorded separately\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSingle Blend Molecular Weight:\u003c\/strong\u003e\n Not applicable; the component molecular weights should be recorded separately\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTotal Declared Peptide Content:\u003c\/strong\u003e\n Sum of the declared BPC-157 and full-length thymosin beta-4 quantities\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eTotal Powder Fill Mass:\u003c\/strong\u003e\n May exceed the declared peptide content where a carrier, bulking agent, counter-ion, residual water or other formulation component is present\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePhysical Form:\u003c\/strong\u003e\n Dry or lyophilised laboratory preparation, as stated in the applicable batch Certificate of Analysis\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAppearance:\u003c\/strong\u003e\n White to off-white laboratory material where confirmed by the applicable batch documentation\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComponent Purity:\u003c\/strong\u003e\n Chromatographic purity should be stated separately for BPC-157 and full-length thymosin beta-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eBlend Composition:\u003c\/strong\u003e\n The individual peptide quantity and final ratio should be confirmed using an appropriate quantitative method\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAnalytical Interpretation:\u003c\/strong\u003e\n Component identity, chromatographic purity, individual peptide content, blend ratio, counter-ion content, water content, residual solvents and bacterial endotoxin results are separate analytical measurements and should be interpreted together\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003ch3 id=\"bpc-157-component-information\"\u003e\n \u003cstrong\u003eComponent 1: BPC-157 Chemical and Structural Information\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eComponent Name:\u003c\/strong\u003e\n BPC-157\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAlternative Names:\u003c\/strong\u003e\n Body Protection Compound-157; pentadecapeptide BPC-157; PL 14736; Bepecin\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic linear pentadecapeptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 15 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Peptide Sequence:\u003c\/strong\u003e\n H-Gly-Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ala-Asp-Asp-Ala-Gly-Leu-Val-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eOne-Letter Sequence:\u003c\/strong\u003e\n GEPPPGKPADDAGLV\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Free glycine amino terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free valine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Structure:\u003c\/strong\u003e\n Linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 137525-51-0\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePubChem Compound Identifier:\u003c\/strong\u003e\n CID 9941957\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e62\u003c\/sub\u003eH\u003csub\u003e98\u003c\/sub\u003eN\u003csub\u003e16\u003c\/sub\u003eO\u003csub\u003e22\u003c\/sub\u003e\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 1419.54 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The formula and molecular weight describe the uncountered BPC-157 free-acid structure without acetate, trifluoroacetate, residual water, solvents or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Confirmation:\u003c\/strong\u003e\n The complete sequence and observed molecular mass should agree with the applicable supplier and batch documentation\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003ch3 id=\"full-length-thymosin-beta-4-component-information\"\u003e\n \u003cstrong\u003eComponent 2: Full-Length Thymosin Beta-4 Chemical and Structural Information\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cul\u003e\n \u003cli\u003e\n \u003cstrong\u003eComponent Name:\u003c\/strong\u003e\n Full-Length Thymosin Beta-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003ePreferred Substance Name:\u003c\/strong\u003e\n Timbetasin\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCatalogue Designation:\u003c\/strong\u003e\n TB500\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMaterial Classification:\u003c\/strong\u003e\n Synthetic N-terminally acetylated linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eSequence Length:\u003c\/strong\u003e\n 43 amino-acid residues\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eComplete Modified Peptide Sequence:\u003c\/strong\u003e\n Ac-Ser-Asp-Lys-Pro-Asp-Met-Ala-Glu-Ile-Glu-Lys-Phe-Asp-Lys-Ser-Lys-Leu-Lys-Lys-Thr-Glu-Thr-Gln-Glu-Lys-Asn-Pro-Leu-Pro-Ser-Lys-Glu-Thr-Ile-Glu-Gln-Glu-Lys-Gln-Ala-Gly-Glu-Ser-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eModified One-Letter Sequence:\u003c\/strong\u003e\n Ac-SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES-OH\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eN-Terminal Structure:\u003c\/strong\u003e\n Covalently N-acetylated serine\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eC-Terminal Structure:\u003c\/strong\u003e\n Free serine carboxylic acid terminus\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCyclic or Linear Structure:\u003c\/strong\u003e\n Linear peptide\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCysteine Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eDisulphide-Bond Content:\u003c\/strong\u003e\n None\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMethionine Content:\u003c\/strong\u003e\n One methionine residue\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eCAS Number:\u003c\/strong\u003e\n 77591-33-4\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eUnique Ingredient Identifier:\u003c\/strong\u003e\n 2D5MRE3SSY\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eMolecular Formula:\u003c\/strong\u003e\n C\u003csub\u003e212\u003c\/sub\u003eH\u003csub\u003e350\u003c\/sub\u003eN\u003csub\u003e56\u003c\/sub\u003eO\u003csub\u003e78\u003c\/sub\u003eS\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eAverage Molecular Weight:\u003c\/strong\u003e\n Approximately 4963.5 g\/mol\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eFormula Basis:\u003c\/strong\u003e\n The formula and molecular weight describe full-length, N-terminally acetylated timbetasin without additional acetate, trifluoroacetate, residual water, solvents or formulation excipients\n \u003c\/li\u003e\n\n \u003cli\u003e\n \u003cstrong\u003eIdentity Confirmation:\u003c\/strong\u003e\n The complete 43-residue sequence, N-terminal acetylation and observed molecular mass should agree with the applicable supplier and batch documentation\n \u003c\/li\u003e\n\u003c\/ul\u003e\n\n\u003ch3 id=\"bpc-157-tb500-blend-quality-documentation\"\u003e\n \u003cstrong\u003eBlend Formulation and Quality Documentation\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n ✓\n \u003cstrong\u003eSeparate component identity\u003c\/strong\u003e\n – BPC-157 and full-length thymosin beta-4 should each be supported by molecular-mass or equivalent identity data.\n \u003cbr\u003e\n\n ✓\n \u003cstrong\u003eComponent-specific chromatographic purity\u003c\/strong\u003e\n – The high-performance liquid chromatography result for each peptide should be reported independently.\n \u003cbr\u003e\n\n ✓\n \u003cstrong\u003eDefined mass composition\u003c\/strong\u003e\n – The Certificate of Analysis should state the nominal and, where determined, measured quantity of each component.\n \u003cbr\u003e\n\n ✓\n \u003cstrong\u003eBlend-ratio confirmation\u003c\/strong\u003e\n – The final preparation should be assessed using a quantitative method suitable for confirming the declared 1:1 peptide-mass ratio.\n \u003cbr\u003e\n\n ✓\n \u003cstrong\u003ePeptide-content documentation\u003c\/strong\u003e\n – Net peptide content should be distinguished from chromatographic area percentage and total powder fill mass.\n \u003cbr\u003e\n\n ✓\n \u003cstrong\u003eExcipient documentation\u003c\/strong\u003e\n – Any carrier, bulking agent or other formulation ingredient should be identified with its applicable quantity or concentration.\n \u003cbr\u003e\n\n ✓\n \u003cstrong\u003eChemical-form documentation\u003c\/strong\u003e\n – Acetate, trifluoroacetate, sodium or another counter-ion should be identified for each component where present.\n \u003cbr\u003e\n\n ✓\n \u003cstrong\u003eWater and residual-solvent documentation\u003c\/strong\u003e\n – Residual water and applicable process solvents should be stated or controlled through the batch specification.\n \u003cbr\u003e\n\n ✓\n \u003cstrong\u003eOxidation-control documentation\u003c\/strong\u003e\n – Methionine oxidation in full-length thymosin beta-4 should be assessed or controlled where required by the applicable specification.\n \u003cbr\u003e\n\n ✓\n \u003cstrong\u003eBacterial endotoxin documentation\u003c\/strong\u003e\n – The test method, reporting units, method-suitability controls, acceptance criterion and batch result should be recorded.\n \u003cbr\u003e\n\n ✓\n \u003cstrong\u003eSafety Data Sheet\u003c\/strong\u003e\n – Supplied to support appropriate laboratory handling, storage and regulatory compliance.\n \u003cbr\u003e\n\n ✓\n \u003cstrong\u003eTrackable laboratory delivery\u003c\/strong\u003e\n – Securely packaged and dispatched using transport controls appropriate to the applicable batch stability and storage specification.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003cp style=\"color: #c00000; line-height: 1.65;\"\u003e\n \u003cstrong\u003eFor Research Use Only\u003c\/strong\u003e\n \u003cbr\u003e\n This product is supplied strictly for scientific research, laboratory analysis and experimental work. It is not intended for human consumption, animal use, clinical use, diagnostic use, pharmacy compounding, self-administration or any form of therapeutic application.\n\u003c\/p\u003e\n\n\u003cdiv style=\"text-align: center;\"\u003e\n \u003chr style=\"width: 100%; border: 0; border-top: 1px solid #cccccc;\"\u003e\n\u003c\/div\u003e\n\n\u003ch3 id=\"bpc-157-tb500-blend-product-overview\"\u003e\n \u003cstrong\u003eBPC-157 \u0026amp; TB500 Blend Product Overview\u003c\/strong\u003e\n\u003c\/h3\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Our\n \u003cstrong\u003eBPC-157 and full-length Thymosin Beta-4 research-grade dual-peptide blend\u003c\/strong\u003e\n is supplied for controlled analytical method development, peptide identity assessment, high-performance liquid chromatography evaluation, liquid chromatography–mass spectrometry workflows, blend-composition analysis, impurity profiling, stability investigation, reference-material comparison and other scientific laboratory applications.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n The formulation contains two chemically distinct peptide components combined at a defined 1:1 ratio by declared peptide mass. BPC-157 is a linear 15-residue peptide with a molecular weight of approximately 1419.54 g\/mol. The TB500 component is full-length, N-terminally acetylated thymosin beta-4 or timbetasin, comprising 43 amino-acid residues and having a molecular weight of approximately 4963.5 g\/mol.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Because PEP066 is a physical mixture, it has no single molecular formula, component molecular weight or CAS Registry Number. The chemical identifiers, complete sequence and analytical result for each component should be recorded independently, while the final preparation should additionally be assessed for declared component quantities and blend ratio.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n Chromatographic purity should not automatically be interpreted as equivalent to total net peptide content or quantitative blend composition. Different peptide components may produce different detector responses, so a chromatographic peak-area ratio should only be treated as a mass ratio where the analytical method and response factors are suitable for that purpose.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n A bacterial endotoxin or lipopolysaccharide result does not establish sterility, complete molecular identity, correct blend composition or the absence of every peptide-related and process-related impurity. Any sterility claim must be supported separately by an appropriate validated sterility test and controlled production documentation.\n\u003c\/p\u003e\n\n\u003cp style=\"color: #000000; line-height: 1.75;\"\u003e\n For the majority of routine analytical method development, chromatographic assessment, mass-spectrometry comparison, blend-characterisation, impurity profiling and general laboratory work, the\n \u003cstrong\u003eRegular BPC-157 \u0026amp; TB500 Blend remains highly suitable\u003c\/strong\u003e.\n The premium black-and-gold ULTIMATE option provides additional preparative high-performance liquid chromatography purification for each peptide component and a more stringent bacterial endotoxin or lipopolysaccharide testing specification for projects requiring enhanced quality-control parameters.\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/coa\/PEP066.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Certificate of Analysis\n \u003c\/a\u003e\n\u003c\/p\u003e\n\n\u003cp\u003e\n \u003ca href=\"https:\/\/researchscientific.co.uk\/msds\/PEP066.pdf\" target=\"_blank\" rel=\"noopener noreferrer\"\u003e\n View Safety Data Sheet\n \u003c\/a\u003e\n\u003c\/p\u003e","brand":"Research Scientific","offers":[{"title":"5mg","offer_id":50256481354066,"sku":"PEP066","price":12.2,"currency_code":"GBP","in_stock":true},{"title":"10mg","offer_id":50256481386834,"sku":"PEP066","price":26.5,"currency_code":"GBP","in_stock":true},{"title":"20mg","offer_id":50532777361746,"sku":"PEP066","price":45.5,"currency_code":"GBP","in_stock":true},{"title":"50mg","offer_id":50532777394514,"sku":"PEP066","price":79.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 1","offer_id":51242184900946,"sku":"PEP066","price":61.95,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 2","offer_id":51242186670418,"sku":"PEP066","price":122.85,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 3","offer_id":51242187653458,"sku":"PEP066","price":107.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 10mg Lab Pack 4","offer_id":51242189291858,"sku":"PEP066","price":213.25,"currency_code":"GBP","in_stock":true},{"title":"5mg Ultimate","offer_id":54670140768594,"sku":"PEP066U","price":23.95,"currency_code":"GBP","in_stock":true},{"title":"10mg Ultimate","offer_id":54670154989906,"sku":"PEP066U","price":38.95,"currency_code":"GBP","in_stock":true},{"title":"20mg Ultimate","offer_id":54670166491474,"sku":"PEP066U","price":62.25,"currency_code":"GBP","in_stock":true},{"title":"50mg Ultimate","offer_id":54670175207762,"sku":"PEP066U","price":105.95,"currency_code":"GBP","in_stock":true},{"title":"5 x 5mg Lab Pack 5 - Ultimate","offer_id":54766581350738,"sku":"PEP066U","price":89.85,"currency_code":"GBP","in_stock":true},{"title":"10 x 5mg Lab Pack 6 - Ultimate","offer_id":54766581383506,"sku":"PEP066U","price":177.5,"currency_code":"GBP","in_stock":true},{"title":"5 x 10mg Lab Pack 7 - Ultimate","offer_id":54766581416274,"sku":"PEP066U","price":155.95,"currency_code":"GBP","in_stock":true},{"title":"10x 10mg Lab Pack 8 - Ultimate","offer_id":54766581449042,"sku":"PEP066U","price":309.5,"currency_code":"GBP","in_stock":true}],"thumbnail_url":"\/\/cdn.shopify.com\/s\/files\/1\/0931\/9769\/7362\/files\/nupex-bpc-157-tb500-blend-uk-peptide-powder.png?v=1767865780"}],"url":"https:\/\/nupex.co.uk\/collections\/buy-research-peptides-uk-pure-lab-tested.oembed?page=7","provider":"Nupex","version":"1.0","type":"link"}